KEGG   Methanobrevibacter smithii: Msm_0560Help
Entry
Msm_0560          CDS       T00539                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, beta subunit, PorB
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00010  Glycolysis / Gluconeogenesis
msi00020  Citrate cycle (TCA cycle)
msi00620  Pyruvate metabolism
msi00633  Nitrotoluene degradation
msi00640  Propanoate metabolism
msi00650  Butanoate metabolism
msi00680  Methane metabolism
msi00720  Carbon fixation pathways in prokaryotes
msi01100  Metabolic pathways
msi01120  Microbial metabolism in diverse environments
msi01130  Biosynthesis of antibiotics
msi01200  Carbon metabolism
Module
msi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0560
   00020 Citrate cycle (TCA cycle)
    Msm_0560
   00620 Pyruvate metabolism
    Msm_0560
   00640 Propanoate metabolism
    Msm_0560
   00650 Butanoate metabolism
    Msm_0560
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msm_0560
   00680 Methane metabolism
    Msm_0560
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msm_0560
Enzymes [BR:msi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msm_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABQ86765
UniProt: A5UKN7
Position
538160..539026
Genome map
AA seq 288 aa AA seqDB search
MEISDKEYLAPGHRGCAGCGASIGVRLALNALGKNTVAISATGCLEVMTSPYPETAWEIP
WMHVAFENAGAVASGVESALRIQGKDDVNVVAFGGDGGTVDIGLQSLSGAMERGHNLTYI
CYDNEAYMNTGIQRSGATPYGASTTTSPNGSGSFGEDKPKKDMPMIMAAHGIPYVATASI
AYPEDFVNKVKKAAEIKGPAYIHLHQPCTTGWGFASEKTIEMGRLAVETGSWILYEVENG
EFNITYRPDERKPVKEYLAPQKRFKHLDDEHIEKIQKYVDKSCEELGL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatctgataaagaatacttagcaccaggacacagaggatgtgcaggttgtgga
gcttccattggagttagattagctcttaatgcattaggaaaaaataccgtagctatttca
gctaccggttgtcttgaagtaatgacctccccttacccagaaaccgcttgggaaattcca
tggatgcatgtagcttttgaaaatgcaggagcagttgcatcaggagtagaaagtgcttta
agaattcaaggaaaagatgatgttaatgttgttgctttcggaggagacggaggaactgta
gatatcggtttacaatcattatccggagcaatggaaagaggacacaacttaacctacatc
tgttacgataacgaagcatacatgaacacaggtatccaaagaagtggtgcaacaccttac
ggtgcaagcactacaacttcaccaaacggaagcggcagttttggagaagacaaacctaaa
aaagatatgcctatgattatggcggcacatggaattccatatgtagctactgcatctatt
gcatatcctgaagactttgtcaacaaagttaaaaaagcagccgaaatcaaaggtcctgca
tacatacatttacaccaaccatgtactacaggatggggatttgcttcagaaaaaactatt
gaaatgggaagattagcagttgaaaccggatcatggattttatatgaagttgaaaacggt
gaattcaacatcacttacagaccagatgaaagaaaaccagttaaagaatacttagctcct
caaaaaagattcaaacatcttgatgatgaacacatagaaaaaatacaaaaatacgttgat
aaatcctgcgaagaattaggcttataa

DBGET integrated database retrieval system