KEGG   Methanobrevibacter smithii: Msm_0615Help
Entry
Msm_0615          CDS       T00539                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msm_0615
   01230 Biosynthesis of amino acids
    Msm_0615
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0615
   00030 Pentose phosphate pathway
    Msm_0615
   00051 Fructose and mannose metabolism
    Msm_0615
  Energy metabolism
   00680 Methane metabolism
    Msm_0615
Enzymes [BR:msi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Msm_0615
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Msm_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(583981..585075)
Genome map
AA seq 364 aa AA seqDB search
MKTTVSVIKADIGSVSGHCVAHPDLMDICDEVLAEALETNILTDYYISRCGDDIDLIMTH
RNGEENEEVHETAYNAFMKATERARELKLYGAGQDLLSDTFSGNIKGMGPGVAEMEFKER
PSDPVLVYCCDKTEPGAFNLPIFKMFADPFNTAGLVIDPSLHDGFKFEVFDVIEHRKVIL
NCPEEMYDLLALIGSTGRYVIKRVWKKNGEIAAAISTERLNLMAGEYVGKDDPAAIVRAQ
SGFPANGECVEPFAFPHMVSGWMRGSHNGPMMPVSERDANPIRFDGPPRVIGLGFQVSDA
KLIGPVDLFDDPAFDPTREESARIATYIRRHGPFEPHRLPAEEMEYTSLPGVMAKLEDRF
EDME
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaactgttagtgtaattaaagctgatattggaagtgtgtctggacattgtgta
gcacacccagatttaatggatatttgtgatgaagttttagcagaagctttagagacaaat
attttaactgattattatatctcccgttgtggagacgacattgacttgattatgactcat
agaaatggggaagaaaacgaagaagttcacgaaactgcttacaatgctttcatgaaagct
actgaaagagcacgtgaattaaaattatacggtgcaggtcaagatttattatctgacacc
ttttctggaaacattaaaggtatgggtcctggtgttgctgaaatggaattcaaagaaagg
ccaagtgaccctgttttagtatactgctgtgacaaaaccgaacctggtgcatttaactta
cctatttttaaaatgttcgcagatccatttaacactgcaggtcttgttattgacccaagt
ttacatgatggattcaaatttgaagtatttgatgtaattgaacacagaaaagttatctta
aactgtcctgaagaaatgtacgatttactcgcattaatcggttctactggaagatacgta
attaaaagagtatggaagaaaaacggagaaatcgcagcagctatcagtactgaaagatta
aacttaatggctggagaatacgttggtaaagatgaccctgcagctattgtaagagcacaa
tctggtttcccagctaatggtgaatgtgtagaaccatttgcattccctcacatggtaagt
ggatggatgagaggttcccacaacggtcctatgatgcctgtatctgaaagagatgcaaac
ccaattagatttgacggaccacctagagtaatcggtttaggtttccaagtatctgatgct
aaattaataggtcctgttgacttatttgatgaccctgcatttgatcctactagggaagaa
tctgcaagaatcgctacctacatcagaagacacggtccatttgaacctcacagattacct
gctgaagaaatggaatatacttcattacctggtgtaatggcaaaactcgaagatagattc
gaagatatggaataa

DBGET integrated database retrieval system