KEGG   Methanobrevibacter smithii: Msm_0648Help
Entry
Msm_0648          CDS       T00539                                 

Definition
phosphomannomutase, ManB (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0648
   00030 Pentose phosphate pathway
    Msm_0648
   00051 Fructose and mannose metabolism
    Msm_0648
   00052 Galactose metabolism
    Msm_0648
   00500 Starch and sucrose metabolism
    Msm_0648
   00520 Amino sugar and nucleotide sugar metabolism
    Msm_0648
  Nucleotide metabolism
   00230 Purine metabolism
    Msm_0648
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msm_0648
Enzymes [BR:msi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Msm_0648
    5.4.2.8  phosphomannomutase
     Msm_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628702..630081
Genome map
AA seq 459 aa AA seqDB search
MRQLIMSDKKRLFGTFGVRRVANEVLTPEFASRLAACYGSVVQGTVAVGGDTRTSSPMLM
EAVKAGLLSSGCDVVDLGILPTPGVQYGVRKYYDGGVMITASHNPPKYNGIKFLDELGIG
IPDEMELEIEKLYFDEEPKRAHWSEIGQLYHNDKIIDEYIDEAISKVDVEAIKKANLKVV
VDCGSGAGSYTAPYLIRKLGCDVTTLNCQADGFFPGRDPEPIEENLQELINVVKQLNADI
GLAHDGDADRTICIDEKGNFVLGDKTFSLVEKQMLKENNGGTIVTTVATSQAIYDIAEEY
NGKVIATAVGDLLVARKLKDENGLFGGEENGGLIFPDFVYGRDAVMTVAKILETIAKEKK
PLSKLVEELPVYYATKTKIECSDDLKDEVMNNIADEIKTTTDFELDTTDGVKILKEDGWV
IIRPSGTEPIFRCFAESDSQEKADAMTEWGLSLIKKYKH
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaattaataatgtcagataaaaaaagattattcgggacttttggagttagaaga
gtagctaatgaagttttaactcctgaatttgcatccagacttgcagcatgttacggatca
gtagttcaaggaacagtagctgttggtggagatacaagaacaagcagtcctatgttaatg
gaagctgtaaaagctggacttttatcttccggttgtgatgttgtagatttaggaattctg
cccactcctggagtccagtatggagttcgcaagtattatgacggtggagttatgattacc
gcatcacataatcctccaaaatataacggaattaaatttttagatgaattaggtattgga
attcctgatgagatggaattggaaattgaaaaattatattttgatgaagaaccgaaaaga
gctcattggagtgaaattggccaattataccacaatgacaaaattattgatgaatacatc
gatgaagcaatcagcaaagtagatgttgaagccattaaaaaagctaatttgaaagttgtt
gttgactgcggttccggagcaggatcatacactgccccttacctgattagaaaattgggc
tgtgatgtaactactctaaactgtcaggcagacggatttttcccaggtcgtgaccctgaa
ccaattgaagaaaacttacaggagctaattaatgttgtaaaacagttaaatgcagatatc
ggacttgctcatgacggagatgcagacagaaccatctgtattgatgaaaaaggaaacttt
gtacttggagacaaaacattttcacttgttgaaaaacagatgcttaaagaaaacaacgga
ggtacaatagttacaactgttgcaacttcacaggcaatttatgatattgctgaagagtac
aacggcaaagtaatagctactgctgttggagatttacttgtggcccgtaaattaaaagat
gaaaatggtttatttggtggagaagaaaacggtggtttaatcttccctgattttgtttat
ggaagagatgcagttatgactgtggctaaaatacttgaaacaatagctaaggagaaaaaa
ccgttatccaaactggttgaagaacttccggtttactatgcaacaaaaacaaaaattgaa
tgcagtgatgacttgaaagatgaagttatgaacaacatagcggatgaaataaaaaccact
actgattttgaacttgataccactgacggtgttaaaatcctaaaagaagacggatgggta
attatcagaccatcaggtactgaaccaatcttcagatgctttgctgaatctgactctcag
gaaaaggcagatgcaatgactgagtggggattaagtttaattaaaaaatacaaacattaa

DBGET integrated database retrieval system