KEGG   Methanobrevibacter smithii: Msm_0716Help
Entry
Msm_0716          CDS       T00539                                 

Definition
oligosaccharyl transferase, STT3 subunit
Orthology
K07151  
dolichyl-diphosphooligosaccharide--protein glycosyltransferase [EC:2.4.99.18]
Organism
msi  Methanobrevibacter smithii
Pathway
Metabolic pathways
Brite
Enzymes [BR:msi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     Msm_0716
Glycosyltransferases [BR:msi01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   Msm_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(683076..685844)
Genome map
AA seq 922 aa AA seqDB search
MNKKTILTISKSAIIILILLAVVFALRAPAADLNILPTGDLKAEYEDASGLPYFSEMDSY
YNLRLTENFVDHGYVGDELVDGSNWDMHRNSPDGDKINYELAIVWVTSFFYNIANQFFGD
YTVQEVAFWTGAIVASLAVVPAFIFARRLTNDLGAITATLIIVLAPNYFAHTFPGFFDTD
MFYYIFSLFFIMFFMESLRSKNLIAKVVFAILSIVSIGLFSQSWTGYIFYVGLMGIFSVV
YLILCYVFNIGDSERELYPSKAAWFVHQKDLMSIVILGVIGFIGLAAFKGVDGVLGIFGS
LTGLLSLQSTSTVVGGFPNVLISVAELQMPSMLGAGMDSFLLANSNGVINGIGGIFVFFA
GLTVLFIFAKRIYDYRNVKQDGNTTKKPPKSQRLASSKKIDDDRKFKISLGSVSKFAKDN
EVTEAKRLNLMFATLFIVWVVITALAVSRGSRFITTIVLPFGLMAGIFVGYASDYVKTKL
DNDKMLMAVILVTGFFASYPLAAVTVPIFGIILFLLIAIAGGITIYGLKSSKSASTKVPV
KKYVAIIAIALALITPTVCGAYQTANQVVPGTSDAMWDSMVWINENTADNTVVASWWDFG
YLFEIAADRQVIFDGGSQSGNSRAFWLGQAMTTDNMDLSAGIFRMLGTSGENATNTLTDY
TGSPGKATDILIDILPKNAQDAKNALINTYGLTTEQANTIIPLTHPDNPRPVIFVASSDM
LQKAGWWSYFGAWDFDKQNSTNFNYYVPSQQVTVEPGSTGRLALINESGLEYDAVITRGT
GNNTTTGHTEAVYSNNGSLLKINGSEFNPLNVSRIMVIEGNQLVKNESIAGAPSDSNYTL
FLMGENNVYTPIIMHNKLADSMFTRLYLLGGMGQNVFSMVHMENGVSLWQVNYNNTAAGG
TSTPAASGATDGNIGTTSPDRA
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaacaatattaacaataagtaaatcagcaatcattattttgattctgtta
gctgttgtttttgcattaagagctcctgcagcggaccttaatattttgcctaccggtgat
ttgaaggcagaatatgaagatgcttcaggtcttccttattttagtgaaatggattcatat
tataacttaaggttgactgaaaatttcgttgatcacggttatgtaggagatgaactagtc
gatggttcaaactgggatatgcataggaattccccagatggagataagattaattatgag
ttagctattgtatgggtaacgtcatttttctacaatatagcaaaccagttcttcggtgat
tacactgttcaggaagttgcattctggaccggtgctattgtagcatctcttgcagttgtt
cctgcatttatctttgctagacgtctgactaatgatttgggtgcaataacagctacattg
ataattgtgcttgcaccaaactattttgcacacacattccctggattttttgatacagat
atgttctactatatcttctcattattcttcataatgttctttatggagagcttgaggtct
aaaaatcttattgcaaaagttgtctttgcaatattgtctattgtatctattggtcttttc
tcccaatcatggacaggatacatcttttatgtaggtcttatgggtatcttttcagttgtg
tacttaatattatgttatgtatttaacattggtgatagtgaaagagagttatacccaagt
aaggctgcttggttcgtacaccagaaggatttaatgtccattgttattttaggtgttatt
ggatttatcggtcttgcagcatttaaaggagtagacggtgtacttggaatatttggcagt
ttaactggtttattgtccttgcaatcaacttcaactgttgtaggtggattccctaatgta
cttatttctgttgcggaattgcaaatgccaagtatgcttggagcaggtatggattcattc
ttgcttgctaattccaatggtgtaataaacggtattggtggaattttcgtattcttcgct
ggtttaacggtattatttatctttgcaaaaaggatatatgattatagaaatgttaaacaa
gacggaaacacaactaaaaaaccgcctaaatcccaaagattggcatcttctaaaaaaatt
gatgatgaccgtaaatttaaaatatctttaggtagcgtaagtaaatttgccaaagataat
gaagtaactgaagctaaacgtttgaacttaatgtttgctactctatttatagtatgggta
gtaattacagcacttgcagtaagtagaggttcaaggttcattaccactattgtattgcca
ttcggtttaatggcaggtatatttgtaggatatgcttctgactatgtcaaaactaaactt
gataatgacaaaatgttaatggcagttatattggtaacaggattctttgcatcataccca
ttagcagcagttacagtacctatattcggtattatattattcctgttaattgctatagct
ggtggaataaccatatacggactgaaatccagtaagtctgcatctactaaagtacctgtt
aagaagtatgttgctattattgctattgctcttgcattgataacacctactgtttgtggt
gcttatcagactgctaatcaggtagtgcctggtactagtgatgctatgtgggattcaatg
gtatggattaatgaaaatactgctgataatactgttgttgcatcctggtgggacttcggt
tacctctttgagattgctgctgacagacaggtaatctttgatggaggtagtcaaagtggt
aacagtagggcattctggctaggtcaggcgatgacgacggataatatggatttgtctgca
ggaatatttagaatgttgggaacttccggtgaaaatgctactaatacattaacagattat
actggcagtccgggtaaagcaactgatattttaattgatatcctgccgaaaaacgcacag
gatgctaaaaatgcattaattaatacatatggtttaactactgagcaggctaatactatt
attccgcttactcatcctgataatccaagaccggttatctttgtagcaagttcagatatg
ttgcaaaaagctggctggtggagttactttggtgcgtgggactttgataagcagaattcc
acaaacttcaattattacgtgccttcccagcaagtaactgttgaacctggatctactggc
agattagctttaattaatgaatccggtttggaatatgatgcagttattactagaggtact
ggaaacaacactactactggtcatactgaagcagtatattcaaataacggttctttactt
aaaataaacggatcagaatttaatccattgaatgtatcccgtatcatggtaattgaaggt
aatcaattagtgaaaaatgaatcaatagctggagctcctagcgattccaattatacatta
ttcctgatgggtgaaaataatgtttacacacctattataatgcataataaattggctgat
tcaatgtttaccagattgtaccttttaggtggtatgggtcagaatgtattctccatggtt
catatggaaaatggagtttcattatggcaagtaaattataacaacacggctgctggcgga
actagtacacctgctgcatctggtgctactgatggaaatattggtactactagtccggac
agggcttaa

DBGET integrated database retrieval system