KEGG   Methanobrevibacter smithii ATCC 35061: Msm_0842Help
Entry
Msm_0842          CDS       T00539                                 

Definition
radical SAM superfamily histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798648..800312
Genome map
AA seq 554 aa AA seqDB search
MENACRIIIEDILKNKINTRKELEVKKRQLCRDLKLSRFMSNADILEYATPQEKEIVSNI
LKKKPTRTMSGVAIVAVMCHPHECPHGRCFYCPKNNNAPPSYTGEEPAALRGRMYEFHPY
IQCFNRLKQLKKIGHPIDKVELIIMGGTFPSRDLCYQEWFVSQCLKAMVDFGLILKNKPE
DNEYNLDPAEIKCFEKDILKSYEPSNYVLIDDVQKANENSKVRCVGMTFETRPDYCKKEH
INRMLDFGVTRVELGVQTLSDELYTKIKRGHTIADVIESNTLLRDSAVKVAMHMMPGLFV
SPDEDLNMFKKLFSDDNFKPDMLKIYPCLVTKGSELYDLWKEGKYNPYTDEEAVDLIVKI
KQILPKWVRTMRIQRDIPSTLIEAGVQKSNLGELVYNKLKEHDINCQCIRCREIGHKKTS
QEYSLDDFKLFKESYNACGGEETFLSIEDKNEESIAGFLRFRIPSPNHYRPEISDETALI
RELHVYGNMIKIGGKNPKIGQHTGFGEKLLKEAEKLAIKKGKDEIAIISGIGTRNYYRKF
GYERKGPYMAKKLI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgcttgtcgcataataattgaggacattttaaaaaacaagataaacaccaga
aaagagctggaagtcaaaaaaagacagttatgtcgtgacttaaagctatccagatttatg
agcaatgcagatattttggaatatgcaactccccaagaaaaagaaattgtttcaaacatc
ttaaagaaaaaacctacccgaacaatgtccggtgttgcaatagttgctgtaatgtgccat
cctcatgaatgccctcacggaaggtgtttttactgtccaaaaaataacaatgcaccacca
agttataccggtgaagaacctgcagccctaagaggtagaatgtatgaatttcatccatat
atacaatgttttaaccgtttgaaacagcttaaaaaaataggacacccaattgataaagtg
gaactcatcataatgggcggaacattcccttccagagacttatgttatcaggaatggttt
gtatcacaatgtctaaaggcaatggttgattttggattgatacttaaaaacaaacctgaa
gacaacgaatacaatttagatcctgcagaaataaaatgctttgaaaaagatattcttaaa
agctatgaaccaagcaattatgtacttattgatgatgttcaaaaagccaatgaaaattcc
aaagtaagatgtgtcggaatgacatttgaaacacgtcctgactactgtaaaaaagaacac
ataaatagaatgcttgattttggagttacaagagttgaattaggtgttcaaactttatct
gacgaattatacactaaaattaaaagaggccatacaatagctgatgtaatagaatcaaat
acacttcttcgtgacagtgccgtaaaagtagcaatgcatatgatgcctggattgtttgta
agtcctgatgaagatttaaatatgttcaaaaagctatttagcgatgataattttaaaccg
gacatgcttaagatttacccgtgtcttgttaccaaaggcagcgagttatatgacctgtgg
aaagaaggaaaatataatccgtatactgatgaagaagctgttgatttaattgttaaaatt
aaacagattcttccaaaatgggttagaaccatgagaattcaaagagacattccatcaaca
ttaattgaagcaggagttcaaaaatccaaccttggagaactggtttacaacaaattaaaa
gaacatgacattaactgccaatgtatccgctgccgcgaaataggtcataaaaaaacaagt
caggaatatagtttagatgattttaaattatttaaagaatcatacaatgcatgcggcggt
gaagaaacctttttatcaattgaagataaaaacgaagaaagtatcgcaggatttttaaga
ttcagaattccttcaccaaatcactacagacctgaaatcagcgatgaaactgcacttata
cgtgaattgcacgtctatggaaatatgattaaaataggtggtaaaaatccaaaaataggt
caacacacaggatttggagaaaaactattaaaagaagctgaaaaattagctatcaagaaa
ggaaaagatgaaatagctataattagcggaatcggaaccagaaattattatcgtaaattt
ggatatgaaagaaaaggtccatatatggctaaaaaattaatctga

DBGET integrated database retrieval system