KEGG   Methanobrevibacter smithii: Msm_0860Help
Entry
Msm_0860          CDS       T00539                                 

Definition
(GenBank) aspartate-semialdehyde dehydrogenase, ArgC
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00220  Arginine biosynthesis
msi01100  Metabolic pathways
msi01110  Biosynthesis of secondary metabolites
msi01130  Biosynthesis of antibiotics
msi01210  2-Oxocarboxylic acid metabolism
msi01230  Biosynthesis of amino acids
Module
msi_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Msm_0860
Enzymes [BR:msi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Msm_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC DapB_N
Motif
Other DBs
NCBI-ProteinID: ABQ87065
UniProt: A5ULI7
Position
816807..817826
Genome map
AA seq 339 aa AA seqDB search
MYNVAIVGASGYTGGELLRMLLNHSEVEVNNITSRKYDGTPAHKIHPHIRDSGLVFKNKQ
PSELDADIIFTATPHGASMKIVPDLLETGTKVIDLSGDYRYRDTKVYEKWYGLEHTSDIK
GVYGLPEIYRDEIKKADLVGNPGCFPTGAILSSYPLVDNDLVDRIVIDSKTGVSGAGVNP
SSTTHYPNIADNVNPYKISSHRHVSEIQQELHGFEDVKVSFTPHLVPVIRGIQTTSHSFL
REEHSDITPDELRKFYEKTYGKEYFIKLMDDGEIPHLSSVRGSNFVHIGGFEIDDTGRIV
MLSCIDNLVRGASGQAIQNMNIMLGLDETTGLNHFGLNP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtataatgtagcaatagtaggagcaagcggatatactggtggagaacttctcagaatg
ttattaaatcatagcgaagtagaagtaaataacattacttcaagaaaatatgacggaaca
cctgcacataaaatacacccgcacataagagattccggattagttttcaaaaataaacag
ccaagtgaattggatgcagatataatatttacagccacccctcacggagcatcaatgaaa
atagttccggacttgcttgaaaccggaactaaagttattgacttaagcggagattacaga
taccgtgacaccaaagtttatgaaaaatggtacggattggaacataccagtgacattaaa
ggtgtttatggtcttccggaaatttacagagatgaaattaaaaaagctgatttggtagga
aatcctggatgtttcccaacaggagcaatattatcctcttaccctttagtagataatgat
ttggttgacagaatagtcattgattcaaaaacaggagttagcggagcaggagtaaatcct
tcaagtaccacacattacccaaatattgcagataatgtcaatccctacaaaatttcttca
cacagacatgtttctgaaattcagcaggaattacatgggtttgaagatgttaaagtttca
tttaccccacatttagttccagttattcgaggaatccaaacaacaagccatagcttctta
agagaagagcattcagacattactcctgatgaattaagaaaattctatgaaaaaacatac
ggtaaagaatacttcattaaattaatggatgatggagaaattcctcatttaagttctgtt
agaggatccaattttgttcatattggaggatttgaaattgatgataccggaagaattgta
atgctgtcctgtatcgataatcttgttagaggtgcatcaggtcaagctatacaaaatatg
aacataatgcttggattagatgaaacaacaggattaaaccattttggacttaatccataa

DBGET integrated database retrieval system