KEGG   Methanobrevibacter smithii ATCC 35061: Msm_0860Help
Entry
Msm_0860          CDS       T00539                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase (EC:1.2.1.38)
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:msi01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:msi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:msi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816807..817826
Genome map
AA seq 339 aa AA seqDB search
MYNVAIVGASGYTGGELLRMLLNHSEVEVNNITSRKYDGTPAHKIHPHIRDSGLVFKNKQ
PSELDADIIFTATPHGASMKIVPDLLETGTKVIDLSGDYRYRDTKVYEKWYGLEHTSDIK
GVYGLPEIYRDEIKKADLVGNPGCFPTGAILSSYPLVDNDLVDRIVIDSKTGVSGAGVNP
SSTTHYPNIADNVNPYKISSHRHVSEIQQELHGFEDVKVSFTPHLVPVIRGIQTTSHSFL
REEHSDITPDELRKFYEKTYGKEYFIKLMDDGEIPHLSSVRGSNFVHIGGFEIDDTGRIV
MLSCIDNLVRGASGQAIQNMNIMLGLDETTGLNHFGLNP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtataatgtagcaatagtaggagcaagcggatatactggtggagaacttctcagaatg
ttattaaatcatagcgaagtagaagtaaataacattacttcaagaaaatatgacggaaca
cctgcacataaaatacacccgcacataagagattccggattagttttcaaaaataaacag
ccaagtgaattggatgcagatataatatttacagccacccctcacggagcatcaatgaaa
atagttccggacttgcttgaaaccggaactaaagttattgacttaagcggagattacaga
taccgtgacaccaaagtttatgaaaaatggtacggattggaacataccagtgacattaaa
ggtgtttatggtcttccggaaatttacagagatgaaattaaaaaagctgatttggtagga
aatcctggatgtttcccaacaggagcaatattatcctcttaccctttagtagataatgat
ttggttgacagaatagtcattgattcaaaaacaggagttagcggagcaggagtaaatcct
tcaagtaccacacattacccaaatattgcagataatgtcaatccctacaaaatttcttca
cacagacatgtttctgaaattcagcaggaattacatgggtttgaagatgttaaagtttca
tttaccccacatttagttccagttattcgaggaatccaaacaacaagccatagcttctta
agagaagagcattcagacattactcctgatgaattaagaaaattctatgaaaaaacatac
ggtaaagaatacttcattaaattaatggatgatggagaaattcctcatttaagttctgtt
agaggatccaattttgttcatattggaggatttgaaattgatgataccggaagaattgta
atgctgtcctgtatcgataatcttgttagaggtgcatcaggtcaagctatacaaaatatg
aacataatgcttggattagatgaaacaacaggattaaaccattttggacttaatccataa

DBGET integrated database retrieval system