KEGG   Methanobrevibacter smithii: Msm_0860Help
Entry
Msm_0860          CDS       T00539                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase (EC:1.2.1.38)
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
msi  Methanobrevibacter smithii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Msm_0860 (argC)
   01230 Biosynthesis of amino acids
    Msm_0860 (argC)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Msm_0860 (argC)
Enzymes [BR:msi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Msm_0860 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816807..817826
Genome map
AA seq 339 aa AA seqDB search
MYNVAIVGASGYTGGELLRMLLNHSEVEVNNITSRKYDGTPAHKIHPHIRDSGLVFKNKQ
PSELDADIIFTATPHGASMKIVPDLLETGTKVIDLSGDYRYRDTKVYEKWYGLEHTSDIK
GVYGLPEIYRDEIKKADLVGNPGCFPTGAILSSYPLVDNDLVDRIVIDSKTGVSGAGVNP
SSTTHYPNIADNVNPYKISSHRHVSEIQQELHGFEDVKVSFTPHLVPVIRGIQTTSHSFL
REEHSDITPDELRKFYEKTYGKEYFIKLMDDGEIPHLSSVRGSNFVHIGGFEIDDTGRIV
MLSCIDNLVRGASGQAIQNMNIMLGLDETTGLNHFGLNP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtataatgtagcaatagtaggagcaagcggatatactggtggagaacttctcagaatg
ttattaaatcatagcgaagtagaagtaaataacattacttcaagaaaatatgacggaaca
cctgcacataaaatacacccgcacataagagattccggattagttttcaaaaataaacag
ccaagtgaattggatgcagatataatatttacagccacccctcacggagcatcaatgaaa
atagttccggacttgcttgaaaccggaactaaagttattgacttaagcggagattacaga
taccgtgacaccaaagtttatgaaaaatggtacggattggaacataccagtgacattaaa
ggtgtttatggtcttccggaaatttacagagatgaaattaaaaaagctgatttggtagga
aatcctggatgtttcccaacaggagcaatattatcctcttaccctttagtagataatgat
ttggttgacagaatagtcattgattcaaaaacaggagttagcggagcaggagtaaatcct
tcaagtaccacacattacccaaatattgcagataatgtcaatccctacaaaatttcttca
cacagacatgtttctgaaattcagcaggaattacatgggtttgaagatgttaaagtttca
tttaccccacatttagttccagttattcgaggaatccaaacaacaagccatagcttctta
agagaagagcattcagacattactcctgatgaattaagaaaattctatgaaaaaacatac
ggtaaagaatacttcattaaattaatggatgatggagaaattcctcatttaagttctgtt
agaggatccaattttgttcatattggaggatttgaaattgatgataccggaagaattgta
atgctgtcctgtatcgataatcttgttagaggtgcatcaggtcaagctatacaaaatatg
aacataatgcttggattagatgaaacaacaggattaaaccattttggacttaatccataa

  All links  
No link information was found.   
DBGET integrated database retrieval system