KEGG   Methanobrevibacter smithii: Msm_0919Help
Entry
Msm_0919          CDS       T00539                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msm_0919
   01230 Biosynthesis of amino acids
    Msm_0919
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0919
   00051 Fructose and mannose metabolism
    Msm_0919
   00562 Inositol phosphate metabolism
    Msm_0919
Enzymes [BR:msi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msm_0919
Exosome [BR:msi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msm_0919
  Exosomal proteins of bladder cancer cells
   Msm_0919
  Exosomal proteins of melanoma cells
   Msm_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(883561..884229)
Genome map
AA seq 222 aa AA seqDB search
MNTPIVILNYKTYLESSGENALELARALKSASEESGITMVAAPQAADIYRIQDQISLPIF
AQHIDPITPGGHTGSNLIETLIEAGISGSLINHSENRMKLADIDEVIQLCKQNDIESCVC
TNNIATSKAIATFSPDAVAVEPPELIGTGIPVSQAQPEVVEDSVKGVKSINKKIKVLCGA
GISTGDDMKAAMDLGADGVLLASGIVKAKNPKEALLDLVSKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgccaattgtaatattaaattataaaacttatttggaatctagcggggaaaat
gcattggagttagctcgtgcattaaaaagtgcttctgaagaatctggtataactatggtt
gcagctccacaagcggcagatatttataggattcaggatcaaatttctttacctattttt
gcacagcacattgatccaattactcctggaggacatacaggttctaatttaattgaaact
ttaattgaagcaggtataagcggtagtttaattaaccactctgaaaatagaatgaaactg
gctgatattgatgaagttatacaattgtgtaagcaaaatgatattgaatcctgtgtttgt
acaaacaatattgcaactagtaaagcaatagctactttcagtcccgatgcagtagctgta
gaacctccggaacttattggtacaggtattccagtatctcaggcacagcctgaagttgtt
gaagactctgttaaaggagttaaatcaatcaacaaaaaaatcaaagtcttatgcggtgca
ggaatatcaactggtgatgatatgaaagccgcaatggatttaggtgcagatggagtttta
ttagcttcaggtattgttaaggctaaaaatcctaaagaagctttacttgatttggttagt
aaattataa

DBGET integrated database retrieval system