KEGG   Methanobrevibacter smithii: Msm_0919Help
Entry
Msm_0919          CDS       T00539                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msm_0919
   01230 Biosynthesis of amino acids
    Msm_0919
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0919
   00051 Fructose and mannose metabolism
    Msm_0919
   00562 Inositol phosphate metabolism
    Msm_0919
Enzymes [BR:msi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msm_0919
Exosome [BR:msi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msm_0919
  Exosomal proteins of bladder cancer cells
   Msm_0919
  Exosomal proteins of melanoma cells
   Msm_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(883561..884229)
Genome map
AA seq 222 aa AA seqDB search
MNTPIVILNYKTYLESSGENALELARALKSASEESGITMVAAPQAADIYRIQDQISLPIF
AQHIDPITPGGHTGSNLIETLIEAGISGSLINHSENRMKLADIDEVIQLCKQNDIESCVC
TNNIATSKAIATFSPDAVAVEPPELIGTGIPVSQAQPEVVEDSVKGVKSINKKIKVLCGA
GISTGDDMKAAMDLGADGVLLASGIVKAKNPKEALLDLVSKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgccaattgtaatattaaattataaaacttatttggaatctagcggggaaaat
gcattggagttagctcgtgcattaaaaagtgcttctgaagaatctggtataactatggtt
gcagctccacaagcggcagatatttataggattcaggatcaaatttctttacctattttt
gcacagcacattgatccaattactcctggaggacatacaggttctaatttaattgaaact
ttaattgaagcaggtataagcggtagtttaattaaccactctgaaaatagaatgaaactg
gctgatattgatgaagttatacaattgtgtaagcaaaatgatattgaatcctgtgtttgt
acaaacaatattgcaactagtaaagcaatagctactttcagtcccgatgcagtagctgta
gaacctccggaacttattggtacaggtattccagtatctcaggcacagcctgaagttgtt
gaagactctgttaaaggagttaaatcaatcaacaaaaaaatcaaagtcttatgcggtgca
ggaatatcaactggtgatgatatgaaagccgcaatggatttaggtgcagatggagtttta
ttagcttcaggtattgttaaggctaaaaatcctaaagaagctttacttgatttggttagt
aaattataa

DBGET integrated database retrieval system