KEGG   Methanobrevibacter smithii: Msm_0962Help
Entry
Msm_0962          CDS       T00539                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase, GapA
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
msi  Methanobrevibacter smithii
Pathway
msi00010  Glycolysis / Gluconeogenesis
msi01100  Metabolic pathways
msi01110  Biosynthesis of secondary metabolites
msi01120  Microbial metabolism in diverse environments
msi01130  Biosynthesis of antibiotics
msi01200  Carbon metabolism
msi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msm_0962
Enzymes [BR:msi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Msm_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C NAD_binding_3 Sacchrp_dh_NADP TrkA_N F420_oxidored Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ABQ87167
UniProt: A5ULT9
Position
924430..925446
Genome map
AA seq 338 aa AA seqDB search
MKSVAINGYGTIGKRVADAVAAQDDMKVIGVSKTRPNYESRTAVEEKGYDLYIGIPERAD
QFKEAGIEIAGTVEDMIQEADVVVDCTPGTIGPQNLEMYKKAGVKAIYQGGEDHELTGLS
FNAISNYDDSYGKDYTRVVSCNTTGLTRTLSTIDPIADIKKVRAVMVRRGSDPSEVKKGP
INSIVPNPPKVPSHHGPDVKTVMEGIDVTTMALLVPTTLMHQHNIMVEINNEVETQEIID
ALEKRSRVLVVDASEGLGSTAELMEYAKELGRNRNDLYEIPVWRESINVVGNELYYMQAV
HQESDVVPENIDAIRALLEMESDNEKSIAKTNKAMGIL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgtagctataaacggatatggaaccataggaaaaagagtagcagatgcagta
gctgctcaagatgatatgaaagtaattggtgtaagtaaaactagacctaattacgaatca
agaactgcagttgaagaaaaaggttatgatttatacattggaattccagaaagagcagac
cagtttaaagaagcaggaattgaaatagctggaactgtagaagacatgattcaggaagcg
gatgttgttgtagactgtactccaggaactatcggtccgcaaaacttggaaatgtataaa
aaagccggagttaaagcaatttatcaaggtggagaagaccacgaattaactggcctttca
tttaatgctatttcaaactatgatgactcatatggtaaagattacacaagagttgtttca
tgtaacactaccggacttacacgtacattaagtactattgacccaattgcagatattaaa
aaggttagagcagtaatggttagaagaggatcagatccttcagaagttaaaaaaggacct
atcaactctattgtaccaaaccctccaaaagtaccttctcaccacggacctgatgtaaaa
actgttatggaaggtattgacgtgacaacaatggcattgcttgttcctacaactcttatg
caccaacacaacataatggttgaaattaataacgaagtggaaacccaagaaattattgat
gcattagaaaaacgttccagagttcttgttgtggatgctagtgaaggtttaggttcaact
gcagagcttatggaatatgctaaagaacttggaagaaacagaaatgatttatacgaaatt
ccagtttggagagaatcaataaatgttgtaggtaacgaattatactacatgcaggctgtt
caccaggaatcagatgttgttccagaaaacattgatgcaattcgtgcattacttgaaatg
gaatcagacaatgaaaaatcaatagctaaaaccaacaaagcaatgggaatcttataa

DBGET integrated database retrieval system