KEGG   Methanobrevibacter smithii ATCC 35061: Msm_1124Help
Entry
Msm_1124          CDS       T00539                                 

Definition
coenzyme F420-reducing hydrogenase, alpha subunit, FrhA (EC:1.12.98.1)
Orthology
K00440  
coenzyme F420 hydrogenase subunit alpha [EC:1.12.98.1]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:msi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1103717..1104934)
Genome map
AA seq 405 aa AA seqDB search
MKDRIVISPTSRQEGHAELVMEVDDEGIVTKGRYLSITPVRGLEKMVAGKNPETAPVLCQ
RICGVCPIPHTLASVEAIDHSLDIEVPKAGKLLRQATLAAHGVNSAAIHHFLIAPDFVPE
EDFTTAVKSVSAVRKNVQYVVDMLAGEGIHPSDIRVGGMARNITSATKDKLIDRLKAFKP
DMEKHVELMKSFIAARELPEGLGVVDAPLLASSASYGNLDEFDYDNFSEVLPEAWYDDPE
IGKKACTTIPLINGKNVETGPRARMDKFNGFKDKGVVAQHVARAEEMLNNYNLTIDLLEQ
IDTSAPARADYDDRGTGKLGIGVIEGPRGTNVHMANVKDSKIQFYSAIVPTTWNIPTMGP
ATEGFHHKYGADVIRAYDPCLSCATHVMVVDDEDKSILKNDMVRI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagacagaatagttatatccccaacatctcgtcaagagggccatgccgaacttgtc
atggaagtcgatgatgaagggattgttacaaaaggtagatatttaagtatcactccagtt
aggggtttagaaaaaatggttgcaggtaaaaatcctgaaacagctcctgttttatgtcaa
aggatttgtggtgtctgcccaataccacatactttagcttctgtagaagctatcgaccat
tcattagatatcgaagttcctaaagcaggaaaattattaagacaggctactttagctgca
catggtgttaacagtgctgcaattcaccattttttaattgcacctgactttgtacctgaa
gaagatttcactactgcagttaaaagtgtatctgctgttaggaaaaatgtacagtatgta
gttgatatgcttgctggtgaaggtattcacccatctgatattagagtaggtggtatggct
agaaacattacttcagctacaaaagataaattgattgataggttaaaagcttttaaaccg
gatatggaaaaacatgtggaattaatgaaatctttcattgctgcaagagaacttcctgaa
ggtttaggagttgtagatgcaccacttttagcatctagtgcatcatacggtaatctcgat
gaatttgattatgataatttctcagaagttttacctgaagcttggtatgatgatccggaa
ataggtaaaaaagcatgtaccaccattcctttaatcaatggtaaaaacgttgaaacaggt
cctagggcaagaatggataaattcaacggatttaaagataaaggtgtagttgctcaacat
gtagctagagctgaagaaatgttaaataattataatttaactattgatcttcttgaacaa
attgatacttccgctccagctagagcagattatgatgacagaggaactggtaaattaggt
attggtgtaattgaaggacctaggggtactaatgtacacatggctaatgttaaagatagt
aaaatccaattctattcagctattgtaccaactacttggaatattccaacaatgggacca
gctactgaaggtttccatcataaatatggtgcagatgttatcagagcttacgacccatgt
ttatcatgtgcaactcacgtaatggtagttgatgatgaggataaaagtatacttaaaaac
gatatggtgagaatataa

DBGET integrated database retrieval system