KEGG   Methanobrevibacter smithii: Msm_1141Help
Entry
Msm_1141          CDS       T00539                                 

Definition
(RefSeq) tryptophan synthase, alpha subunit, TrpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msm_1141
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msm_1141
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msm_1141
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msm_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1119479..1120252)
Genome map
AA seq 257 aa AA seqDB search
MSKIANAFKDGKAFIGFLTAGDPTIEKTVEYILAMEEAGCDLIEIGIPFSDPMAEGVVIQ
DANIRALGHNTTTDDVFEIVRKVRQKTDVPLVFLTYINPVFFYGYEKFFKKCGELGIDGI
ISPDLPYEEKGEIKDIALSNDVDVISLIAPTSKERIQKIASDATGFIYVVSSLGVTGMRS
EIKTDLKSILDDIRAVSDLPLAVGFGINTPEQASNIGKIADGVIVGSAIVKIIEEHGENA
AEPLKEYVSAMKTACNE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatagcaaatgcatttaaggacggtaaggcatttatcggatttttaactgca
ggagatccgacaattgaaaaaacagtagaatatattttggcaatggaagaagcaggttgc
gatttaatagaaattggaattccgttttcagatcctatggctgaaggagttgtaattcag
gatgcaaatataagggcattaggccataatacaacaactgacgatgtatttgaaatagtc
aggaaagttcgccaaaaaacagatgttccattagtatttttaacttacattaaccctgtt
ttcttttatggttatgaaaaattctttaaaaaatgcggtgaacttggaatcgatggaatt
atatcacctgacctgccttatgaagaaaaaggtgaaatcaaagacattgcattatctaat
gatgttgatgtcatttctctgattgctccaacttcaaaggaaaggattcaaaaaatagcc
agtgatgcaacaggttttatttatgttgtttcttctttgggagttactggaatgcgcagt
gaaataaaaacggacctgaaatctattttagatgatattcgtgcagtcagtgacttgcca
ttagctgttggatttggtattaacacacctgaacaggcttctaacattgggaaaatagct
gatggagttattgtgggaagtgctattgtaaaaatcattgaggagcatggtgaaaatgca
gcagaaccattaaaagaatatgtgtcagctatgaaaacagcctgcaatgaataa

DBGET integrated database retrieval system