KEGG   Methanobrevibacter smithii: Msm_1142Help
Entry
Msm_1142          CDS       T00539                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msm_1142
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msm_1142
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msm_1142
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msm_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1120245..1121444)
Genome map
AA seq 399 aa AA seqDB search
MEAKNMNNGRYGEYGGQYISETLMNELIYLEEQYYHYMNDSEFVEELNTLLKEYAGRPSL
LYYAKRMTEDLGGAKIYLKREDLNHTGAHKINNVLGQVLLAKKMGKTRVIAETGAGQHGV
ATATAAALLDMECEVYMGELDTKRQALNVYRMELLGAKVHPVKSGTKTLKDAVNDAFRDW
IGRVHDTNYVIGSTMGPHPFPMMVRDFQAVISAEAREQFLEKEGKLPDAVLACVGGGSNA
MGAFYNFIDDADVKLIGCEAGGKGVDTPYNAAALTNGQIGIFHGMKSIFNQGEYGQISEV
YSVSAGLDYPGVGPEHAYLRDIKRAEYVPVTDEEAVNAFEYLSKMEGIIPAIESAHAVAH
AMKIAPKMDKDEIIMVCLSGRGDKDVASIAKYRGVELNE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggaggctaaaaacatgaataatggaagatacggggaatatggaggacaatatatctct
gaaactttaatgaatgaattgatttacttggaagaacagtattatcactatatgaatgat
tctgaatttgtagaagaattaaatacacttttaaaagaatatgctggcagaccttcttta
ttatactatgcaaaaagaatgactgaagatttgggaggagctaagatttatttaaagcgt
gaagatttaaatcacactggagctcataaaatcaacaatgtgcttggtcaggttttactg
gctaaaaaaatgggaaaaacaagagtaatagctgaaactggagcaggccaacatggggta
gctacagcaacagcagcagcacttctggatatggaatgtgaagtgtacatgggtgagtta
gataccaaacgtcaggctttaaatgtttataggatggaattgcttggagcaaaagttcat
ccggtaaaatcaggaacaaaaacactaaaggatgcagttaatgatgcatttagagattgg
attgggagagttcatgatacaaattatgtaataggttcaacaatggggccgcatcctttt
ccaatgatggttagagacttccaagcagtaataagtgctgaagctcgtgaacaatttttg
gaaaaagaaggaaaacttccggatgcagttttagcatgtgttggtggtggaagtaatgca
atgggagcattttacaatttcatagatgatgcggatgttaaattaattggatgtgaagca
ggaggaaaaggagtagatactccttataatgcagcagctttaactaatgggcaaatcgga
atatttcacggaatgaaatcaatatttaatcagggagaatatgggcagatatctgaagtc
tattctgtctcagcaggtctggattatcctggagtaggacctgaacatgcatatttaaga
gatattaaaagagcagagtatgttcctgttacagatgaagaagcagtcaatgcttttgaa
tacttgtcaaaaatggaaggaatcattccggctattgaaagtgctcatgcagtagcacat
gcaatgaaaatagctccaaaaatggataaagacgaaattatcatggtttgtctttctgga
aggggagacaaagatgtagcatcaattgcaaaatataggggagttgagttaaatgagtaa

DBGET integrated database retrieval system