KEGG   Methanobrevibacter smithii: Msm_1142Help
Entry
Msm_1142          CDS       T00539                                 

Definition
(GenBank) tryptophan synthase, beta subunit, TrpB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msi  Methanobrevibacter smithii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msm_1142
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msm_1142
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msm_1142
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msm_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1120245..1122026)
Genome map
AA seq 593 aa AA seqDB search
MVKIKICGLKRLEDIELANRYKIDYAGFVFAESKRKVNYDLAKQMKEKLCEDIQSVGVFV
DAGTDEILKLYNDGIIDVAQLHGMESEDYIKTLKEKTDYKLKIIKAIEVSENTDLSKYDD
SLADYLLLDSGKGSGKTFDWHLIRKDLKKEFFLAGGLNSKNITQAIGEFKPYAIDLSSGV
ESDGFKDENKIKKVMEAKNMNNGRYGEYGGQYISETLMNELIYLEEQYYHYMNDSEFVEE
LNTLLKEYAGRPSLLYYAKRMTEDLGGAKIYLKREDLNHTGAHKINNVLGQVLLAKKMGK
TRVIAETGAGQHGVATATAAALLDMECEVYMGELDTKRQALNVYRMELLGAKVHPVKSGT
KTLKDAVNDAFRDWIGRVHDTNYVIGSTMGPHPFPMMVRDFQAVISAEAREQFLEKEGKL
PDAVLACVGGGSNAMGAFYNFIDDADVKLIGCEAGGKGVDTPYNAAALTNGQIGIFHGMK
SIFNQGEYGQISEVYSVSAGLDYPGVGPEHAYLRDIKRAEYVPVTDEEAVNAFEYLSKME
GIIPAIESAHAVAHAMKIAPKMDKDEIIMVCLSGRGDKDVASIAKYRGVELNE
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaattaaaatctgcggacttaaaagactggaggatattgaacttgcaaacagg
tataaaatagattatgcaggttttgtatttgctgagagcaaaagaaaagtaaattatgat
cttgcaaaacaaatgaaggaaaaactctgcgaagatattcaaagtgttggtgtttttgta
gatgcaggcactgatgaaatcctaaaattatacaatgatggtataattgatgtggcacag
cttcatggaatggaaagcgaagattatattaaaactttgaaagaaaaaacagattataag
ttaaagattattaaagctattgaagtatctgaaaatacggatttgtctaaatatgatgat
tcattagctgattatttgttgcttgacagtggaaaaggatcggggaaaacctttgactgg
catttgattagaaaagacttgaaaaaagaattctttttggcaggaggattaaatagcaaa
aacatcactcaggctattggagaatttaagccatatgcaattgatttaagcagcggtgtt
gaaagtgacggatttaaagatgaaaataaaataaaaaaagtcatggaggctaaaaacatg
aataatggaagatacggggaatatggaggacaatatatctctgaaactttaatgaatgaa
ttgatttacttggaagaacagtattatcactatatgaatgattctgaatttgtagaagaa
ttaaatacacttttaaaagaatatgctggcagaccttctttattatactatgcaaaaaga
atgactgaagatttgggaggagctaagatttatttaaagcgtgaagatttaaatcacact
ggagctcataaaatcaacaatgtgcttggtcaggttttactggctaaaaaaatgggaaaa
acaagagtaatagctgaaactggagcaggccaacatggggtagctacagcaacagcagca
gcacttctggatatggaatgtgaagtgtacatgggtgagttagataccaaacgtcaggct
ttaaatgtttataggatggaattgcttggagcaaaagttcatccggtaaaatcaggaaca
aaaacactaaaggatgcagttaatgatgcatttagagattggattgggagagttcatgat
acaaattatgtaataggttcaacaatggggccgcatccttttccaatgatggttagagac
ttccaagcagtaataagtgctgaagctcgtgaacaatttttggaaaaagaaggaaaactt
ccggatgcagttttagcatgtgttggtggtggaagtaatgcaatgggagcattttacaat
ttcatagatgatgcggatgttaaattaattggatgtgaagcaggaggaaaaggagtagat
actccttataatgcagcagctttaactaatgggcaaatcggaatatttcacggaatgaaa
tcaatatttaatcagggagaatatgggcagatatctgaagtctattctgtctcagcaggt
ctggattatcctggagtaggacctgaacatgcatatttaagagatattaaaagagcagag
tatgttcctgttacagatgaagaagcagtcaatgcttttgaatacttgtcaaaaatggaa
ggaatcattccggctattgaaagtgctcatgcagtagcacatgcaatgaaaatagctcca
aaaatggataaagacgaaattatcatggtttgtctttctggaaggggagacaaagatgta
gcatcaattgcaaaatataggggagttgagttaaatgagtaa

DBGET integrated database retrieval system