KEGG   Methanobrevibacter smithii: Msm_1206Help
Entry
Msm_1206          CDS       T00539                                 

Gene name
hisB
Definition
imidazoleglycerol-phosphate dehydratase (EC:4.2.1.19)
Orthology
K01693  
imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
msi  Methanobrevibacter smithii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msm_1206 (hisB)
  Amino acid metabolism
   00340 Histidine metabolism
    Msm_1206 (hisB)
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     Msm_1206 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205953..1206531)
Genome map
AA seq 192 aa AA seqDB search
MDRKSNVSRTTSETDIQIEMNLDGKGKYNISTGVNFFNHMLEAFSKHSMIDLVVDAKGDI
EIDDHHTIEDVGILLGEAFRQAIGDKRGIKRMADATVPMDESVAKVAIDISGRSYCNMEF
DFTNEKIGDMTSEIVVHFFESFVSSAKLNIYGVSKGANDHHQAEAVFKAFAKSLKEAIKI
EHDEIPSTKGVL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaatcaaatgtttcaagaactacatctgaaacagatatacaaatagaaatg
aatcttgacggaaagggaaaatataatatttcaactggtgtgaatttttttaatcatatg
ctggaggcattttcaaaacattcaatgattgatttggttgttgatgcaaaaggagacatt
gaaattgatgaccatcacactattgaagatgtcggtatattattgggtgaagctttcagg
caagctattggagataaaaggggaattaaaagaatggctgatgctacagtacctatggat
gaatcagtagctaaagtagctattgatattagtgggcgcagctattgcaatatggaattt
gattttactaatgaaaaaattggagacatgacttctgaaattgttgttcacttttttgag
tcatttgtatcttcggctaaattaaatatttacggggtttcaaaaggagcaaatgatcat
catcaggctgaagcggtctttaaagcttttgccaaatcattaaaagaagcaataaagata
gagcatgatgagattcctagtacaaaaggtgttttataa

DBGET integrated database retrieval system