KEGG   Methanobrevibacter smithii ATCC 35061: Msm_1206Help
Entry
Msm_1206          CDS       T00539                                 

Gene name
hisB
Definition
imidazoleglycerol-phosphate dehydratase (EC:4.2.1.19)
Orthology
K01693  
imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:msi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205953..1206531)
Genome map
AA seq 192 aa AA seqDB search
MDRKSNVSRTTSETDIQIEMNLDGKGKYNISTGVNFFNHMLEAFSKHSMIDLVVDAKGDI
EIDDHHTIEDVGILLGEAFRQAIGDKRGIKRMADATVPMDESVAKVAIDISGRSYCNMEF
DFTNEKIGDMTSEIVVHFFESFVSSAKLNIYGVSKGANDHHQAEAVFKAFAKSLKEAIKI
EHDEIPSTKGVL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaatcaaatgtttcaagaactacatctgaaacagatatacaaatagaaatg
aatcttgacggaaagggaaaatataatatttcaactggtgtgaatttttttaatcatatg
ctggaggcattttcaaaacattcaatgattgatttggttgttgatgcaaaaggagacatt
gaaattgatgaccatcacactattgaagatgtcggtatattattgggtgaagctttcagg
caagctattggagataaaaggggaattaaaagaatggctgatgctacagtacctatggat
gaatcagtagctaaagtagctattgatattagtgggcgcagctattgcaatatggaattt
gattttactaatgaaaaaattggagacatgacttctgaaattgttgttcacttttttgag
tcatttgtatcttcggctaaattaaatatttacggggtttcaaaaggagcaaatgatcat
catcaggctgaagcggtctttaaagcttttgccaaatcattaaaagaagcaataaagata
gagcatgatgagattcctagtacaaaaggtgttttataa

DBGET integrated database retrieval system