KEGG   Methanobrevibacter smithii ATCC 35061: Msm_1237Help
Entry
Msm_1237          CDS       T00539                                 

Definition
dihydroxy-acid dehydratase (EC:4.2.1.9)
Orthology
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:msi01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:msi01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:msi00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:msi00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1240098..1241747
Genome map
AA seq 549 aa AA seqDB search
MKSDNIKKGIQRAPHRSLLRACGLGDNDFDKPFIGIANSFTEIVPGHIHLRELVEFVKEG
IIAAGGIPFEFNTMAICDGISMNHEGMKYSLPSREIIAATVESMAKGHSFDGLVLMPSCD
KVVPGMLMGAARVDVPTIVVTGGPMAAGQYKGKNADLITVFEAVGQESAGKISEEEVYEI
EKCACPGAGSCSGLFTANTMACVTETLGLSLPFCATTHAADKANEKMAYNSGKQIIKLVE
ADLKPSDILTQEAFNNAITVDMALGGSSNTALHIPAIANEVEDVEVTLDLFDKISRVVPH
ICLISPAGTDTMMDLHKAGGIPGVLKTLGDKIDTSAITVTTKTLGENIKDVEVTNTDVIH
PLDNPIHKDGGIAILKGNIAPNGSVVKKGAVSPDLMHLKGPAKVFNSEEEVTQAIFDHEV
EEGDILVIRYEGPKGGPGMREMLNPTSALAGMQIKNVGLITDGRFSGGTRGPCIGHVSPE
AMSDGPIGAIEDGDIIEIDIENRFINVELSDEEISNRLANRKNPKRDVDGWLSIYSKVVQ
SADTGAILR
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgacaatattaaaaaaggaattcaaagagcaccacataggtctttacttagg
gcatgcggtcttggagataatgattttgataaaccttttattggaatagctaacagtttc
acagaaattgttcccggacatattcatcttagagaacttgttgaatttgtaaaagaagga
ataatagctgctggtggtattccatttgaatttaacactatggctatttgtgatggaatc
agtatgaatcatgaaggaatgaaatactcacttccttccagagaaatcatagctgccact
gttgaaagtatggctaaaggacatagctttgacggattagtgcttatgcccagctgtgat
aaagtagttccaggtatgcttatgggagctgccagagtggatgttcctacaatcgtagtt
accggaggaccaatggcagcaggacaatacaaaggtaaaaatgcagatttaattacagta
tttgaagctgtcggtcaggaatctgctggtaaaatatctgaagaagaagtctacgaaatt
gaaaaatgcgcctgccccggtgcaggcagctgctcaggattatttactgcaaataccatg
gcatgcgtaacagaaactctcggattgtccctgccgttttgtgctacaacacatgcagca
gataaggcaaatgaaaaaatggcttacaattcaggaaaacaaattataaaattagtagaa
gctgacttaaaaccttctgatattttaacacaggaagcatttaacaacgcaattacagta
gacatggctcttggaggatcaagcaatacagcacttcatattccagcaatagctaatgaa
gttgaagatgttgaagttactcttgatttatttgacaaaatcagcagagtagttccccat
atttgtctaatttcaccagcaggtacagacacaatgatggatttacataaagctggagga
attccaggagtattaaaaacacttggagataaaatcgacacatctgctattactgttaca
acaaaaacattaggggaaaacataaaagatgttgaagttacaaatactgatgtcattcat
ccattagataaccctatacataaagatgggggaatagctatattaaaaggaaatattgcg
cctaatggatcagttgttaaaaaaggtgcagtttcaccagatttaatgcatctcaaagga
cctgctaaagtattcaacagtgaagaagaagttactcaagctatatttgaccacgaagtg
gaagaaggagacattttagtaatcagatatgaaggtcctaaaggcggtcctggaatgagg
gaaatgttaaatcctacctctgcacttgcaggtatgcaaatcaaaaatgtaggactcatt
acagatggaagattctcaggaggaactagaggcccatgtatcggacatgtatcacctgaa
gcaatgtctgacggtccaattggagccattgaagatggagatataatagaaattgatatt
gaaaacagattcataaatgtagaactatctgatgaagaaatatcaaatagattagctaat
agaaaaaatccaaaaagagatgttgatggatggttatcaatatacagtaaagttgttcaa
tcagcagataccggagctatattgaggtaa

DBGET integrated database retrieval system