KEGG   Methanobrevibacter smithii: Msm_1237Help
Entry
Msm_1237          CDS       T00539                                 

Definition
dihydroxy-acid dehydratase (EC:4.2.1.9)
Orthology
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
msi  Methanobrevibacter smithii
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Msm_1237
   01230 Biosynthesis of amino acids
    Msm_1237
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Msm_1237
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Msm_1237
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     Msm_1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1240098..1241747
Genome map
AA seq 549 aa AA seqDB search
MKSDNIKKGIQRAPHRSLLRACGLGDNDFDKPFIGIANSFTEIVPGHIHLRELVEFVKEG
IIAAGGIPFEFNTMAICDGISMNHEGMKYSLPSREIIAATVESMAKGHSFDGLVLMPSCD
KVVPGMLMGAARVDVPTIVVTGGPMAAGQYKGKNADLITVFEAVGQESAGKISEEEVYEI
EKCACPGAGSCSGLFTANTMACVTETLGLSLPFCATTHAADKANEKMAYNSGKQIIKLVE
ADLKPSDILTQEAFNNAITVDMALGGSSNTALHIPAIANEVEDVEVTLDLFDKISRVVPH
ICLISPAGTDTMMDLHKAGGIPGVLKTLGDKIDTSAITVTTKTLGENIKDVEVTNTDVIH
PLDNPIHKDGGIAILKGNIAPNGSVVKKGAVSPDLMHLKGPAKVFNSEEEVTQAIFDHEV
EEGDILVIRYEGPKGGPGMREMLNPTSALAGMQIKNVGLITDGRFSGGTRGPCIGHVSPE
AMSDGPIGAIEDGDIIEIDIENRFINVELSDEEISNRLANRKNPKRDVDGWLSIYSKVVQ
SADTGAILR
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgacaatattaaaaaaggaattcaaagagcaccacataggtctttacttagg
gcatgcggtcttggagataatgattttgataaaccttttattggaatagctaacagtttc
acagaaattgttcccggacatattcatcttagagaacttgttgaatttgtaaaagaagga
ataatagctgctggtggtattccatttgaatttaacactatggctatttgtgatggaatc
agtatgaatcatgaaggaatgaaatactcacttccttccagagaaatcatagctgccact
gttgaaagtatggctaaaggacatagctttgacggattagtgcttatgcccagctgtgat
aaagtagttccaggtatgcttatgggagctgccagagtggatgttcctacaatcgtagtt
accggaggaccaatggcagcaggacaatacaaaggtaaaaatgcagatttaattacagta
tttgaagctgtcggtcaggaatctgctggtaaaatatctgaagaagaagtctacgaaatt
gaaaaatgcgcctgccccggtgcaggcagctgctcaggattatttactgcaaataccatg
gcatgcgtaacagaaactctcggattgtccctgccgttttgtgctacaacacatgcagca
gataaggcaaatgaaaaaatggcttacaattcaggaaaacaaattataaaattagtagaa
gctgacttaaaaccttctgatattttaacacaggaagcatttaacaacgcaattacagta
gacatggctcttggaggatcaagcaatacagcacttcatattccagcaatagctaatgaa
gttgaagatgttgaagttactcttgatttatttgacaaaatcagcagagtagttccccat
atttgtctaatttcaccagcaggtacagacacaatgatggatttacataaagctggagga
attccaggagtattaaaaacacttggagataaaatcgacacatctgctattactgttaca
acaaaaacattaggggaaaacataaaagatgttgaagttacaaatactgatgtcattcat
ccattagataaccctatacataaagatgggggaatagctatattaaaaggaaatattgcg
cctaatggatcagttgttaaaaaaggtgcagtttcaccagatttaatgcatctcaaagga
cctgctaaagtattcaacagtgaagaagaagttactcaagctatatttgaccacgaagtg
gaagaaggagacattttagtaatcagatatgaaggtcctaaaggcggtcctggaatgagg
gaaatgttaaatcctacctctgcacttgcaggtatgcaaatcaaaaatgtaggactcatt
acagatggaagattctcaggaggaactagaggcccatgtatcggacatgtatcacctgaa
gcaatgtctgacggtccaattggagccattgaagatggagatataatagaaattgatatt
gaaaacagattcataaatgtagaactatctgatgaagaaatatcaaatagattagctaat
agaaaaaatccaaaaagagatgttgatggatggttatcaatatacagtaaagttgttcaa
tcagcagataccggagctatattgaggtaa

DBGET integrated database retrieval system