KEGG   Methanobrevibacter smithii ATCC 35061: Msm_1238Help
Entry
Msm_1238          CDS       T00539                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:msi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1241753..1243027
Genome map
AA seq 424 aa AA seqDB search
MELLRYEDIDLSQTVKRSEEDVNNVLDTVSDILKNVRQNKDQSLKDYTQKFDKVIIDNLK
VTDEEIKEAYDTLDDNLLEALKKAAANIEKFHKKEIPEEWNIEVREGITAGQIVRPINSV
GCYIPGGRAAYPSTILMTVIPAKIAGVKKIICCSPPQKDGKIGDAILVAAHLAGADEIYK
VGGAQAIGAMAYSTESIPKVEKIVGPGNIFVTAAKKLVYGEVDIEFPAGPSEVLILADKT
ANAEYIATDILSQAEHDPKASCFFVTDDENLAEDVLEFVDKKTEDAPRAEIIKEALSNSG
KIILTKNFEDAVYVTNEYAPEHLVIMTKDDESTLSQINNAGSIFLGKYSPVACGDYGSGT
NHVLPTGGGAKMYSGLSTESFIKKPTVQKITQEGLEKISTTCIPIAEYEGLFAHVDSIKT
RLNK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaacttttaagatatgaggatattgatttatcacaaactgttaaaagatcagaagaa
gatgtaaacaatgttttagacaccgtatctgatattttaaaaaatgttagacaaaataaa
gatcaatccttaaaagattatacacaaaaattcgacaaagtcataatagataatttaaaa
gttacagatgaagaaataaaagaagcttatgatacattagatgacaatttattggaagct
ctgaaaaaagcggctgcaaatattgaaaaatttcataaaaaagaaattcctgaagaatgg
aatattgaagttagagaaggcataactgccggacaaattgtaagaccaataaacagtgtt
ggctgttatattccagggggaagagcagcttacccctctacaattctaatgactgtgatt
cctgcaaaaatagcgggagttaaaaaaattatctgctgttcacctccacaaaaagacggt
aaaataggtgatgcaattttagtagctgctcatttagccggagccgatgaaatatataaa
gtaggtggggctcaggctattggagctatggcttatagtaccgaaagcattcctaaagtt
gaaaaaattgtaggtcctggaaacattttcgtaaccgctgctaaaaaattagtgtatgga
gaagtggacatcgagtttccggcaggaccgtctgaagtgctaatacttgcagataaaaca
gctaatgcagaatatattgctacagacatattatcacaagcagaacatgaccctaaagca
tcctgcttttttgtaacagatgatgaaaacttagctgaagatgttttagaatttgtagat
aaaaaaactgaagatgctccaagagctgaaatcataaaagaagctctgtctaatagcgga
aaaattatccttactaaaaactttgaagatgcagtatatgttacaaatgaatatgctccg
gaacacttagttattatgacaaaagatgacgaaagcacattaagtcagataaataatgca
ggatctatatttttaggaaaatattctccagttgcatgtggagattatggatccggaact
aaccatgtacttccaacaggtggaggagctaaaatgtattccggattgtctacagaatca
tttattaaaaaaccgacagttcaaaaaatcacacaggaaggtttggaaaaaatatcaaca
acatgcatcccaatagctgaatatgaaggattatttgcacatgttgactcaatcaaaacc
agattaaataaatag

DBGET integrated database retrieval system