KEGG   Methanobrevibacter smithii ATCC 35061: Msm_1242Help
Entry
Msm_1242          CDS       T00539                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:msi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:msi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:msi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1246482..1247783)
Genome map
AA seq 433 aa AA seqDB search
MNYKIELSSEEVPKKWYNINADLPCELPMPKNSEGRNQIEDLQKAFTKAALDQEFATERY
IKIPQKVRELYMQMGRPTPLFRAKRLEEKLNTPAKIYYKREDTSPTGSHKLNSAIPQAYF
AKKEGVERLTTETGAGQWGTALSLACSLLDLDCTVYMVKVSFNQKPDRKNIMNIYGGEVF
ASPSENTEFGRKVLAENPDHVGSLGIAISEAMEEALNNDNVKYTLGSVLNHVMLHQTVIG
QELKTQLEIANEEPDTMIACVGGGSNFAGALYPFIKDKLDGNSDTKFIAVEPSACPTLTE
GKYEYDFGDSNGFTPLLKMYTLGHDFVAPSVHAGGLRYHGMCPQISLLAHEGYINPVTAH
QRDVFNAGIQFAKCEGIVPAPETTHAIKAGIDEAIKCRQTGEEKTIVINFSGHGMLDLKG
YANYFSGEMPNSK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaattataaaatagaattatcctctgaagaagtgccaaaaaaatggtacaatattaac
gctgatttaccttgtgaacttccaatgccaaaaaatagtgaaggaagaaatcaaattgaa
gatttgcaaaaagcatttacaaaagcggcactggaccaggagtttgcaactgaaagatac
attaagattccacaaaaagtaagggagttatacatgcagatgggaaggccaactccgtta
tttagagctaaacgtcttgaagaaaagctcaacactccagctaaaatttattacaaaagg
gaagatacttctcctacgggatcacataaattaaacagtgcaattccacaggcatacttt
gctaaaaaagaaggtgttgaaagattaacaaccgaaactggtgcaggacaatggggaact
gctttgtcacttgcttgttcattacttgatttggactgtactgtatatatggttaaagta
tcatttaatcaaaagccagacaggaaaaacatcatgaatatttatggcggagaagtcttt
gcctccccaagtgaaaatacagaatttggacgtaaagtattggctgaaaaccctgaccat
gtaggatcacttggaatagctatttcagaagcaatggaagaagctctaaacaatgacaat
gtaaaatacactttaggcagtgtgttaaaccatgtaatgttacatcaaactgtcatcggt
caggaacttaaaacacaattggaaatagctaatgaagaaccagacactatgattgcatgt
gttggtggtggaagtaactttgcaggtgctttatatccatttattaaagataaacttgat
ggaaacagtgatactaaatttattgcagtagaaccgagtgcatgtccaacattaactgaa
ggtaaatatgaatacgactttggagattcaaatggatttactccacttcttaaaatgtat
accttaggccatgactttgtagcaccatctgtacatgcaggaggtttaagataccatgga
atgtgtccacaaatctcattacttgcacatgaaggatatatcaatcctgtaacagctcat
caaagagacgtatttaatgcaggaattcaatttgctaaatgtgaaggaattgttccggca
ccggaaactactcatgcaattaaggcaggtattgatgaagctattaaatgcagacaaact
ggagaagaaaaaaccattgttattaacttctcaggacatggtatgctggatttaaaaggt
tatgcaaattatttctctggtgaaatgccaaacagtaaatag

DBGET integrated database retrieval system