KEGG   Methanobrevibacter smithii: Msm_1308Help
Entry
Msm_1308          CDS       T00539                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
msi  Methanobrevibacter smithii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Msm_1308
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msm_1308
Enzymes [BR:msi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Msm_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1324756..1325313
Genome map
AA seq 185 aa AA seqDB search
MGNFKFTKTDIEGMFVVEPAVYGDNRGYFMETYNENDFKKAGYDLTFVQDNQSQSFKGVL
RGLHLQLKYPQGKLVRVIKGEVFDVGVDLRADSPTYGKWHGEILSAENKKQLYIPPKFAH
GFVVLSDEAEFVYKCTEFYHGEDEGGIMWNDPDIAVEWPLEGIDEITLSDKDKKWKSLKE
SQIKY
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattttaaatttacaaaaactgatattgaaggaatgtttgtagttgaacctgca
gtctatggggacaatagaggatatttcatggaaacatataatgaaaacgatttcaagaag
gcaggttatgatttaacttttgtacaggataatcagtcacagtcatttaaaggagtgctt
agagggcttcacttacagttaaaatatcctcagggaaaattagttagagttattaagggg
gaagtatttgatgttggggtggatcttagagcagattccccaacttatggtaaatggcat
ggggaaatcctttcagctgaaaataaaaaacagttatacatacctcctaaatttgctcat
ggttttgtcgtattgtctgatgaagctgaatttgtatacaaatgcacagaattttaccat
ggtgaagatgaagggggaatcatgtggaatgacccagatatagctgttgaatggccatta
gaaggaattgatgaaatcactctgtctgataaggataaaaaatggaaaagcttaaaggaa
tcacagattaagtattag

  All links  
No link information was found.   
DBGET integrated database retrieval system