KEGG   Methanobrevibacter smithii: Msm_1389Help
Entry
Msm_1389          CDS       T00539                                 

Definition
(GenBank) sugar kinase, ribokinase/pfkB superfamily
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
msi  Methanobrevibacter smithii
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Msm_1389
   00240 Pyrimidine metabolism
    Msm_1389
Enzymes [BR:msi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     Msm_1389
    2.7.1.213  cytidine kinase
     Msm_1389
    2.7.1.-  
     Msm_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1409912..1410826)
Genome map
AA seq 304 aa AA seqDB search
MAKNRDLLSIGHSALDYIIRVPEFPKANFSAPINDMKTFNGGAAANVALVGAKLGLKTSL
VSAVGGDFKKSNYYEIMESLDVNTDSLIIVPGETSPTAFVLTDENDDQISYFYWGAAKEF
ASSKVPTQAISNAEAVHLATGDPHFNWKCSEEAKKQDLLVSFDPGQDLGMYDTDKLRDVI
TNTTILFGNHHEIRRILESLEVDLDGLREIGPKIIVKTCGANGSEIYSNNEKIKIDAIVR
EAVDPTGAGDSYRAGFLSRFLNGESLEQSAKFASSVSSFIVEEQGCQTNMPTFDDAFDRM
SEFY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaacagagatttactatctatcggacattctgcacttgattatatcattaga
gtaccagagtttcctaaagctaatttctcagcaccaataaacgatatgaagacatttaat
ggtggtgctgcagctaatgttgcacttgttggagcaaaactaggtttaaaaacatcatta
gtttcagcagtaggtggggactttaaaaaatccaattattatgaaataatggaaagttta
gatgtaaatactgattcattaatcatagttcctggagaaacaagtcctacagcatttgtt
ttaactgatgaaaatgatgaccagattagctatttctactggggagctgctaaagaattt
gcatcaagtaaagtgcctacacaagcaatatccaatgcagaggctgttcatttagctact
ggtgatcctcactttaactggaaatgtagtgaagaagcaaaaaaacaggatttacttgtt
tcttttgaccctggtcaggatcttggaatgtacgatacagacaaattaagagacgttatt
acaaatactaccatcctttttggaaaccatcatgaaattagaagaatactggaatcatta
gaagtggatttagacggattaagggaaatcggtcctaaaattattgtaaaaacctgcgga
gctaatgggagtgaaatctattcaaacaatgaaaaaatcaaaattgatgctattgttcgt
gaagctgtggatcctactggagcaggagactcctacagggcaggatttttatcaagattc
ttaaacggagaatcacttgaacaatctgctaaatttgcatcatcagtatcctcttttatt
gtagaagaacaaggatgtcaaactaacatgcctactttcgatgatgcctttgatagaatg
agtgaattttattaa

DBGET integrated database retrieval system