KEGG   Methanobrevibacter smithii: Msm_1408Help
Entry
Msm_1408          CDS       T00539                                 

Definition
tungsten formylmethanofuran dehydrogenase, subunit E, FwdE (EC:1.2.99.5)
Orthology
K00204  
4Fe-4S ferredoxin
Organism
msi  Methanobrevibacter smithii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msm_1408
  Energy metabolism
   00680 Methane metabolism
    Msm_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434758..1435219
Genome map
AA seq 153 aa AA seqDB search
MVVYMPKHIASGLKYLAAVKLKEQGESQQAIANELGIDRSTVSHYLNGSNLSWNSIDVAK
TITDLTPRDFLKMTSAIFDEPEQSRKIVSICNDREFEAVVADSCIGCGLCVSMCSMKAIK
LESLKAHVDSIQCCGCQLCKDECPTNSIKILEI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttatatgccaaaacatattgcatctggtttgaaatatttagctgcagtgaag
ctaaaagagcaaggtgaaagccaacaagcaatagctaatgagttaggtattgataggtct
acagtatcccattatttaaatggcagtaatttatcttggaattctatagacgttgccaaa
actatcactgacctgactcctagagatttcttaaaaatgaccagtgcaatatttgatgaa
cctgaacaaagccgtaaaattgtttctatttgtaatgatagggaatttgaggcagttgtt
gcagattcatgtatcggttgtggcttatgtgtaagcatgtgttctatgaaagctattaaa
ttagaatcgttaaaagcacatgtagactccatacaatgttgcggttgtcagctatgtaaa
gatgagtgcccaacgaattctattaaaattttggagatttaa

DBGET integrated database retrieval system