KEGG   Methanobrevibacter smithii: Msm_1408Help
Entry
Msm_1408          CDS       T00539                                 

Definition
(GenBank) tungsten formylmethanofuran dehydrogenase, subunit E, FwdE
  KO
K00204  4Fe-4S ferredoxin
Organism
msi  Methanobrevibacter smithii
Pathway
msi00680  Methane metabolism
msi01100  Metabolic pathways
msi01120  Microbial metabolism in diverse environments
msi01200  Carbon metabolism
Module
msi_M00567  Methanogenesis, CO2 => methane
msi_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Msm_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_7 HTH_3 HTH_23 Fer4_9 HTH_38 HTH_19 HTH_28 Fer4_16 HTH_7 CENP-B_N Fer4_6 HTH_24 Fer4_10 Fer4_2 TnsD Fer4_17 HTH_26 HTH_29 Fer4_4 Fer4_22 HTH_5 Sigma70_r4_2 HTH_IclR HTH_37 HTH_31 HTH_40 GerE MarR_2 HTH_Tnp_ISL3 YdaS_antitoxin Fer4_15 Sigma70_r4 MqsR_toxin HTH_10 HTH_8 RepB Fer4_13
Motif
Other DBs
NCBI-ProteinID: ABQ87613
UniProt: A5UN35
Position
1434758..1435219
Genome map
AA seq 153 aa AA seqDB search
MVVYMPKHIASGLKYLAAVKLKEQGESQQAIANELGIDRSTVSHYLNGSNLSWNSIDVAK
TITDLTPRDFLKMTSAIFDEPEQSRKIVSICNDREFEAVVADSCIGCGLCVSMCSMKAIK
LESLKAHVDSIQCCGCQLCKDECPTNSIKILEI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttatatgccaaaacatattgcatctggtttgaaatatttagctgcagtgaag
ctaaaagagcaaggtgaaagccaacaagcaatagctaatgagttaggtattgataggtct
acagtatcccattatttaaatggcagtaatttatcttggaattctatagacgttgccaaa
actatcactgacctgactcctagagatttcttaaaaatgaccagtgcaatatttgatgaa
cctgaacaaagccgtaaaattgtttctatttgtaatgatagggaatttgaggcagttgtt
gcagattcatgtatcggttgtggcttatgtgtaagcatgtgttctatgaaagctattaaa
ttagaatcgttaaaagcacatgtagactccatacaatgttgcggttgtcagctatgtaaa
gatgagtgcccaacgaattctattaaaattttggagatttaa

DBGET integrated database retrieval system