KEGG   Methanobrevibacter smithii: Msm_1476Help
Entry
Msm_1476          CDS       T00539                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
msi  Methanobrevibacter smithii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msm_1476
Enzymes [BR:msi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Msm_1476
Exosome [BR:msi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Msm_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1501340..1502341
Genome map
AA seq 333 aa AA seqDB search
MVFPVTRMRRYRKNSKIRDIVRETKLDKEDLIYPIFFKEELQGDEKEPIESMPGEYRYSL
NAGIEFAKQLEEKGLKSIIVFGVPLPESKDEVASPDYSSTGIVQRAIRELKKQTDLVVIG
DVCLCQYTSHGHCGLIKENDDTDDGVEILNDESLEYLAKVAVSYAKAGVDIVAPSDMMDG
RVDAIRTALDENGFYNVMIMSYSAKYASAFYEPFRAAADSSPTHGNRKSYQMDPANALEA
IRECELDVIEGADFLMVKPALPYLDIIKTIREEFTLPLVSYNVSGEYSMIMAAIEKGFLT
ENAILESLISIKRAGSDLIITNFASYVLLNDLL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtatttccagttacaagaatgagaagatatagaaaaaactctaaaattagagatatt
gttcgtgaaactaaattagacaaagaagatttgatttatcctatttttttcaaagaagaa
cttcagggtgatgaaaaagaaccgattgaatctatgcctggtgaatacagatattcatta
aatgcaggtattgaatttgcaaaacaactggaagaaaaaggtttaaaatcaatcattgtc
tttggggttccattgcctgaaagtaaagatgaggtggccagtccggattactcatctacc
ggaatagttcaaagagcaattcgtgaacttaaaaaacagactgatctggttgttattggt
gatgtatgtttgtgccaatacacttctcatggacactgcggattaatcaaagaaaatgat
gatactgacgatggagtggaaatattaaatgatgaatcattggaatatcttgctaaagta
gctgtttcttatgctaaagcaggtgtagatattgtagctccttctgacatgatggatggc
agggtagacgctattaggacagctctggatgaaaatggattttataatgttatgattatg
tcatattcagcaaaatatgcatctgcattttatgaaccattcagggcagctgctgattca
tcaccaactcacggaaaccgtaaaagttatcagatggatcccgccaatgctttagaagca
atcagagaatgtgaacttgatgtgattgaaggtgctgactttttaatggttaaaccggct
ttgccttatctggatattattaaaacaatcagggaagaatttaccttacctttagttagc
tataatgtaagtggagaatactcaatgattatggcggctattgaaaaaggatttttaact
gaaaatgcaattttggaaagtttaatttctattaaaagagcaggatcagacttgataatt
actaactttgcatcatatgtgcttttaaacgatttgctttaa

DBGET integrated database retrieval system