KEGG   Methanobrevibacter smithii: Msm_1604Help
Entry
Msm_1604          CDS       T00539                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase, GalU (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msi  Methanobrevibacter smithii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Msm_1604
   00052 Galactose metabolism
    Msm_1604
   00500 Starch and sucrose metabolism
    Msm_1604
   00520 Amino sugar and nucleotide sugar metabolism
    Msm_1604
Enzymes [BR:msi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Msm_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1666797..1667648
Genome map
AA seq 283 aa AA seqDB search
MKAVIPAAGFGTRFLPATKAQPKEMLPVFDKPTIQYVIEEAVASGIDDILIVTGKNKRSI
EDHFDKSFELEYTLKQAGKTKYLKQVQDITDLADICYIRQKEQKGLGDAIYCAKKHVGEE
PFAVMLGDTITKGKTPCTKQLIDIYNKYEASAISLEKVPQEKVERYGIIKGEEIETDVYQ
IDELVEKPPVDQAPSNLAIMGRYVLTPDIFDKIKETGAGVGGEIQLTDALAKLDKIYGNT
FEGKTYDIGNRLEWLKTSIEFAMDDEESKNDLISYMKEIIASN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaattccggcagctggttttgggactaggtttttgccagctactaaagca
caacctaaagaaatgttgcctgtttttgataaacctactattcagtatgttattgaggaa
gctgtagcttcaggtattgatgatattttaattgtaactggtaaaaataaacgttctatt
gaagatcattttgataaatcatttgaattggagtatactttaaagcaggctggtaagact
aaatatttaaaacaggttcaggatatcactgatttggctgatatttgttatattcgtcaa
aaagagcaaaaaggattaggtgatgcaatttattgtgccaaaaaacatgtgggagaggaa
ccttttgcagtaatgcttggagatacaataacgaaaggaaaaactccatgtacaaaacag
ttaatagatatttacaacaaatacgaagcatcagctatttctcttgaaaaggtacctcag
gaaaaagtggaaagatacggtataattaaaggagaagaaatagaaacagatgtttatcag
attgatgaacttgttgaaaaaccaccagttgatcaggcaccgtctaacttagctattatg
ggaagatatgtactcactccagacattttcgataaaatcaaagaaaccggagctggagtt
ggaggagaaattcagcttactgatgcgctggctaaattagataaaatttatggaaatacc
tttgaaggaaaaacctatgatataggaaatcgtttagaatggttgaaaacatctatagaa
tttgcaatggatgatgaagaatctaaaaacgatttaatcagttatatgaaagaaattata
gcttcaaattaa

DBGET integrated database retrieval system