KEGG   Methanobrevibacter smithii ATCC 35061: Msm_1604Help
Entry
Msm_1604          CDS       T00539                                 

Definition
UDP-glucose pyrophosphorylase, GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
msi  Methanobrevibacter smithii ATCC 35061
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:msi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:msi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:msi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1666797..1667648
Genome map
AA seq 283 aa AA seqDB search
MKAVIPAAGFGTRFLPATKAQPKEMLPVFDKPTIQYVIEEAVASGIDDILIVTGKNKRSI
EDHFDKSFELEYTLKQAGKTKYLKQVQDITDLADICYIRQKEQKGLGDAIYCAKKHVGEE
PFAVMLGDTITKGKTPCTKQLIDIYNKYEASAISLEKVPQEKVERYGIIKGEEIETDVYQ
IDELVEKPPVDQAPSNLAIMGRYVLTPDIFDKIKETGAGVGGEIQLTDALAKLDKIYGNT
FEGKTYDIGNRLEWLKTSIEFAMDDEESKNDLISYMKEIIASN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaattccggcagctggttttgggactaggtttttgccagctactaaagca
caacctaaagaaatgttgcctgtttttgataaacctactattcagtatgttattgaggaa
gctgtagcttcaggtattgatgatattttaattgtaactggtaaaaataaacgttctatt
gaagatcattttgataaatcatttgaattggagtatactttaaagcaggctggtaagact
aaatatttaaaacaggttcaggatatcactgatttggctgatatttgttatattcgtcaa
aaagagcaaaaaggattaggtgatgcaatttattgtgccaaaaaacatgtgggagaggaa
ccttttgcagtaatgcttggagatacaataacgaaaggaaaaactccatgtacaaaacag
ttaatagatatttacaacaaatacgaagcatcagctatttctcttgaaaaggtacctcag
gaaaaagtggaaagatacggtataattaaaggagaagaaatagaaacagatgtttatcag
attgatgaacttgttgaaaaaccaccagttgatcaggcaccgtctaacttagctattatg
ggaagatatgtactcactccagacattttcgataaaatcaaagaaaccggagctggagtt
ggaggagaaattcagcttactgatgcgctggctaaattagataaaatttatggaaatacc
tttgaaggaaaaacctatgatataggaaatcgtttagaatggttgaaaacatctatagaa
tttgcaatggatgatgaagaatctaaaaacgatttaatcagttatatgaaagaaattata
gcttcaaattaa

DBGET integrated database retrieval system