KEGG   Mycoplasma suis KI3806: Msui00520Help
Entry
Msui00520         CDS       T01442                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
msk  Mycoplasma suis KI3806
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Msui00520 (tdk)
Enzymes [BR:msk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Msui00520 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
52010..52591
Genome map
AA seq 193 aa AA seqDB search
MKSGKSKELFSIIDRLNYQKINYKIFKPKLDSRNSNTISSRYFSQSNLAIIINELNPSEI
LDFIPETLSNPLTALIDEAHFFSHELINVVKLMLFKGVNVVISGLDCDANMNPFGPMGDL
MALANRIKKLNSVCEVCYSTANWSALKDSSQTFERENILVGNDQYVVLCLSCYEKHTGIY
KKLLAEPTTSNNS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggaaaatcaaaagaattattttccataattgataggcttaactatcaaaaa
ataaattacaagatatttaagcctaagttagactccagaaactctaacactatatcttct
agatatttttctcagtctaacttggcaataataattaatgaattaaatccaagtgaaatc
ttggattttattccagaaacactatctaatcccttaacagctttaattgatgaagctcat
ttcttttctcatgagctcatcaatgtagttaagttaatgctatttaagggagtaaatgta
gttatatcgggattagattgtgatgctaatatgaacccatttggtccaatgggagatttg
atggcattagcaaacagaataaagaaacttaattctgtttgtgaagtatgctacagtaca
gctaattgaagtgcccttaaagattcctctcaaacatttgagagagaaaacatattggta
gggaatgaccaatatgtagttctatgtctttcttgctatgaaaaacatacaggaatatat
aagaagttgttggctgagcctacaacatctaataactcctaa

DBGET integrated database retrieval system