KEGG   Mycoplasma suis KI3806: Msui00520Help
Entry
Msui00520         CDS       T01442                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
msk  Mycoplasma suis KI3806
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:msk00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
52010..52591
Genome map
AA seq 193 aa AA seqDB search
MKSGKSKELFSIIDRLNYQKINYKIFKPKLDSRNSNTISSRYFSQSNLAIIINELNPSEI
LDFIPETLSNPLTALIDEAHFFSHELINVVKLMLFKGVNVVISGLDCDANMNPFGPMGDL
MALANRIKKLNSVCEVCYSTANWSALKDSSQTFERENILVGNDQYVVLCLSCYEKHTGIY
KKLLAEPTTSNNS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggaaaatcaaaagaattattttccataattgataggcttaactatcaaaaa
ataaattacaagatatttaagcctaagttagactccagaaactctaacactatatcttct
agatatttttctcagtctaacttggcaataataattaatgaattaaatccaagtgaaatc
ttggattttattccagaaacactatctaatcccttaacagctttaattgatgaagctcat
ttcttttctcatgagctcatcaatgtagttaagttaatgctatttaagggagtaaatgta
gttatatcgggattagattgtgatgctaatatgaacccatttggtccaatgggagatttg
atggcattagcaaacagaataaagaaacttaattctgtttgtgaagtatgctacagtaca
gctaattgaagtgcccttaaagattcctctcaaacatttgagagagaaaacatattggta
gggaatgaccaatatgtagttctatgtctttcttgctatgaaaaacatacaggaatatat
aagaagttgttggctgagcctacaacatctaataactcctaa

DBGET integrated database retrieval system