KEGG   Mycoplasma suis KI3806: Msui00570Help
Entry
Msui00570         CDS       T01442                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msk  Mycoplasma suis KI3806
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:msk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msui00570 (tpiA)
   01230 Biosynthesis of amino acids
    Msui00570 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msui00570 (tpiA)
   00051 Fructose and mannose metabolism
    Msui00570 (tpiA)
   00562 Inositol phosphate metabolism
    Msui00570 (tpiA)
Enzymes [BR:msk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msui00570 (tpiA)
Exosome [BR:msk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msui00570 (tpiA)
  Exosomal proteins of bladder cancer cells
   Msui00570 (tpiA)
  Exosomal proteins of melanoma cells
   Msui00570 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56856..57566
Genome map
AA seq 236 aa AA seqDB search
MARKVIIGNLKMNLLRHELNFYLTELRKKLQNETPKHKFGLSFPYIYLEKTAEEIGGQLQ
IFAQDVHHAEKGAYTSFISAPQLSSIKVYSTLIGHSECREMGQTEEIVSKKVRSALLNGL
EVIYCCGKDPLKEIKNELFFLNSKTVEKISIAFEPISAIGTGEAMPPEVAVKNLKAIREL
AIDMWGESGKKITLLYGGSVNQKNYQSYLSEPAIDGILVGSAALNINSLWEMVMGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaggttattattggaaatctgaaaatgaaccttttgagacatgaacttaat
ttctacttaacagagttaagaaagaaattacaaaatgaaactccaaaacataagtttggt
ttgtcttttccatatatatatctggaaaagactgccgaagaaataggaggacaacttcaa
atatttgctcaagatgtacaccacgcagaaaaaggagcatatacttccttcatttctgcc
cctcaattgagttctattaaggtttactcaaccttaataggacattctgaatgtagagaa
atgggccaaacagaagaaattgtttctaagaaggttagatcagctcttctaaatggatta
gaagttatttattgttgcgggaaagatccactgaaagaaataaagaatgaattattcttt
ttgaattcaaagactgtagaaaaaatttctatagcctttgaacctattagtgctataggt
actggagaagcaatgcccccagaagtagcagtaaaaaacttaaaagctataagagaattg
gctatagatatgtggggagaaagtggtaaaaaaataactttactatatggaggatcagta
aatcaaaaaaattatcaaagttatctttcagaacctgctatagatggaatactagtaggt
tctgcagccttaaatatcaattccctttgagaaatggttatgggaagatag

DBGET integrated database retrieval system