KEGG   Mycoplasma suis KI3806: Msui02380Help
Entry
Msui02380         CDS       T01442                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msk  Mycoplasma suis KI3806
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Msui02380 (glpK)
Enzymes [BR:msk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Msui02380 (glpK)
Exosome [BR:msk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Msui02380 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189663..191171
Genome map
AA seq 502 aa AA seqDB search
MTGEDIVLSIDLGSTALKLILFSSTRKQILCEEHPFGTYFPKEGWVEHDGEEIWGVLEKS
LSKLLDSLKKEDYPSFLSISTQRESVLLWTIGEGKSLSPIISWQDNRTEKFINDLDNRER
DFIRERTGLWITTYSSATKLNYLVKEICEKMKGQDYLMGTLESWLIYKLTKGQHFVSDYS
SASRTALLNLKTLEWDPELCDFFDVPIDKLPKLIENDREITGVKVGNHNLSIKGVVGDQQ
GALYFAKKVSEVNSSLVYGTGAFLLNLTSEELDFQDLLDSFKGENSPLITLAWKKVNELP
RFALEWSFSNCGQSLEWLRKHINYKDLSALNNLNLEQFNLLNCPLCLPFFSGKWLLSSRE
SWNSSFYSISSQSKSEDWIISYFEGLAFSIRAVLEEAGIKESENILVGGGLTRNNLFSAI
QSNGLGRSLIISQWIQLSGIGVALFALQNIPKCDTKEVSIDQNKSPLFKFRYKQWSKLSW
QNEKFRNSNNLWEKIILKNDYC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaggggaggatatagttttatctattgatttgggatctacagcccttaaattaatt
cttttttcttcaactagaaaacaaatactttgtgaagaacatccatttggaacttatttt
cccaaagaaggttgagtagaacatgatggagaagaaatatgaggagttctagaaaaaagt
ctttctaaactactagattctctaaagaaggaggattatccctcctttttatccatttct
actcagagagaaagtgttctactctgaacaattggtgagggaaaatcacttagtccaatt
atttcatgacaagacaatagaactgaaaagttcataaatgacctagataatagggaaaga
gattttattagggagagaacaggtctctgaataacaacttatagttcagccacaaaactg
aactatttagttaaagaaatatgtgaaaaaatgaagggacaagactatctaatgggaaca
ttagaaagttgactaatttataagttgactaaaggtcaacattttgtatctgattattca
tcagcttcaagaacagcacttctaaatctaaaaactctggaatgagatccagagttatgt
gatttctttgatgttcctatcgataaattacctaaattaatcgaaaatgatagggaaata
actggagttaaagttggaaatcacaacttgagtattaaaggggtagtaggagatcagcaa
ggagctctttacttcgcaaagaaagttagtgaagtaaattcttcgctagtttatggaact
ggagctttcttactgaacttaacttcagaagaattggatttccaagacttattggattct
tttaagggagaaaatagtcctctaattacattagcttgaaagaaagttaatgaacttcca
agatttgcacttgagtgaagtttttctaattgtgggcaatctttggaatgattgcgcaag
cacataaattataaagacttaagtgcactaaataacttaaatttagagcaatttaatctc
ttaaattgccctttatgtttgccattcttttcgggaaagtgattgctttcatctagagag
agttggaattcatctttctattcaattagtagtcagtcaaagtctgaagattgaattatt
tcatactttgagggattagctttttcaatacgagcagtattggaagaagctggaataaaa
gaaagtgaaaacatattagtagggggaggattgactagaaataacttatttagtgcaatc
caatctaatggattgggaagatcgctaataatttctcagtgaattcaattaagtggaata
ggagtagctttatttgcacttcaaaacatacctaaatgtgacactaaagaggtatctatt
gaccaaaataaaagtccattatttaagttcaggtacaagcagtggagcaagctttcctga
caaaatgagaagttcagaaactctaataatttatgagaaaaaataattttgaaaaatgac
tattgttaa

DBGET integrated database retrieval system