KEGG   Mycoplasma suis KI3806: Msui03170Help
Entry
Msui03170         CDS       T01442                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
msk  Mycoplasma suis KI3806
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:msk00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
273384..273848
Genome map
AA seq 154 aa AA seqDB search
MSFTSRSPRVGEIDSKDYYFISKEKFEKLIQEDRFLEHAYFFGEYYGTSRDTVQELLEQG
KNVILEIEVIGFWQIKRKIEDFVSIFIYPPSLEHLRERLVKRQTEDKENIDRRLKKAEEE
LKEIVHFKHTVLNDNIEQALLSLTQIITSEVGSD
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctttacatctagatctcccagagtgggagaaatagattcaaaggactactacttt
atttccaaagaaaaatttgagaaattaatccaagaagatagattcttggagcatgcttat
ttctttggagaatattatggtacttctagagatactgttcaagaacttcttgaacaggga
aaaaatgtaattctagaaatagaagttataggtttctgacaaattaagagaaaaatagaa
gactttgtttctatatttatctatcctccgtctttagaacatttaagagaaagattagtc
aaaagacagacggaggataaagaaaatatagatagaagattaaagaaagcagaagaagag
cttaaagagatagttcactttaagcacacagtattaaatgacaatatagaacaagctctt
ctttctcttactcagataatcacttccgaggtaggaagtgattaa

DBGET integrated database retrieval system