KEGG   Mycoplasma suis KI3806: Msui03310Help
Entry
Msui03310         CDS       T01442                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
msk  Mycoplasma suis KI3806
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msk00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Msui03310 (gltX)
Enzymes [BR:msk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Msui03310 (gltX)
Amino acid related enzymes [BR:msk01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Msui03310 (gltX)
Transfer RNA biogenesis [BR:msk03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Msui03310 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(286296..287438)
Genome map
AA seq 380 aa AA seqDB search
MYRCFCTEEELEKEREENPYLYSGKCKHLSKEEIDEKLANGVPYCYRLKLDQSKEYVWED
YVRGKMTVPASSMGEIILMRSNGLPTYNFAVVVDDYEMKISDIFRGEEHLSNTPYQIALY
EAFGWEEFIPNFGHLSLIMSAETGKKISKRDVNAQKYLVSYFLEKGYHPEALLNYLLLLG
WTCGEREFFNLKESISNFSISGLSGSPSICDFKKLEWMSFSYLSKMDVFQYLNFVLPFFK
GNIEGFQLSEEMKKEFAIRFRSRVKYAYSLVEISEEFYSKKYLNEEFFEKLKGYENIEEF
IEKTLSFFTSNQVESWTEAEARLLLKKLFNELGTPKPDICHKLRFLLTGDPEGLPMYSTI
LLLGQDNICSRLRDVSEKLK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgtacagatgtttttgtacagaagaagaactagagaaagaaagggaagaaaatccctat
ctttactctgggaaatgtaaacatctttctaaagaagagatagatgaaaaactagctaat
ggagttccatattgctatagactgaagctggatcagtctaaagaatatgtatgagaagac
tatgttaggggaaaaatgactgttccagcttcttctatgggggaaataatacttatgaga
agtaatgggcttccaacctacaactttgcagtagttgtggatgactatgaaatgaaaata
tcagatattttcaggggagaagaacacctctcaaatactccttaccaaatagctttatat
gaagcttttggatgggaagaatttattcctaattttggacatctttccctaataatgtcg
gcagagacaggaaaaaagatttctaagagagatgtaaatgcacaaaaatatctagtaagt
tactttctagaaaagggatatcatccagaagctcttctaaattatttgctccttttaggt
tgaacttgtggtgaaagagaatttttcaacctaaaagaaagtatttctaacttttcaata
tcgggtttaagtggatctccttctatttgtgatttcaagaagttggaatgaatgagcttc
tcttatctaagtaagatggatgtttttcaatatttgaattttgtattgcctttctttaag
ggcaatatagaggggtttcaattgtctgaagaaatgaagaaagaatttgcaattagattc
agatctagagttaagtatgcttattctctagttgaaatttccgaagagttctatagtaag
aaatacttaaatgaagaattctttgaaaaactaaaaggatatgaaaatattgaagaattt
attgaaaaaactttgagttttttcacttccaatcaagtagagtcttgaactgaagcagaa
gcaagactattgctaaaaaaattatttaatgagttgggaactccaaaacctgatatttgt
cataaattaagattccttttaactggcgatccagaaggacttccaatgtattcaactatt
ctcttgttgggacaagataatatctgctctagattgagagatgtttcagaaaaactaaag
tag

DBGET integrated database retrieval system