KEGG   Mycoplasma suis KI3806: Msui06570Help
Entry
Msui06570         CDS       T01442                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msk  Mycoplasma suis KI3806
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:msk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msui06570 (pfkA)
   01230 Biosynthesis of amino acids
    Msui06570 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msui06570 (pfkA)
   00030 Pentose phosphate pathway
    Msui06570 (pfkA)
   00051 Fructose and mannose metabolism
    Msui06570 (pfkA)
   00052 Galactose metabolism
    Msui06570 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Msui06570 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Msui06570 (pfkA)
Enzymes [BR:msk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Msui06570 (pfkA)
Protein phosphatases and associated proteins [BR:msk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Msui06570 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(547537..548520)
Genome map
AA seq 327 aa AA seqDB search
MRKVAILTSGGDAPGMNSSLYSFSKLATQKGYEVLYVKNGYQGFINGEFTSIDLNQLKKG
VYSPGTVIGSSRSPEFKSFPEARAKGVQQLKDKGVEALVVLGGNGSYEGAELISKLGLPV
ILLPATIDNDVTSSEYTIGFFSALEEISQSIRKIWYTAESHSQLTFVEVMGRDCSDLAVL
ASSASPLVDYVITSKNVPSFEELKSRISSLKSSGRKGIVILVVEKILGKSALPSMGELTS
KLESELGFTVRGCVLGHTQRGAIPTSWELFVSSQFGRKAFEAFDSKEFDIAIGFNGTSFY
KTSIDKLDSSSKGDRLSLIEEKNSLVS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaaggtagctattttaacttcaggaggtgatgctcctggaatgaatagttcccta
tactcattcagtaagttagctactcaaaaaggttacgaagttctatatgttaagaatgga
tatcaaggattcattaatggtgaattcacatccatcgatctaaatcaattaaagaaagga
gtttattctcctggaacagttattggttcaagtagatctcctgaatttaagtcttttcct
gaagcaagagctaaaggagttcaacaactaaaggataagggagtggaagcactagtagtt
ttgggaggtaatggatcatatgaaggagcagaattaatttctaagctgggacttccagtt
attttgcttccagcaacaattgataatgatgttacttctagtgaatacactataggtttc
ttttcagcactagaagaaatttcccaatcaattagaaagatttgatatacagctgaatct
cattcccaattaacttttgttgaagttatgggaagagattgctctgatctagctgtacta
gcttctagtgcttctccactagttgactatgttattacttcaaagaatgttccatccttt
gaagaacttaagtcaagaatttcttctcttaagagttcaggaagaaaaggtattgttatc
ctagtagtggaaaaaattcttggtaagtcagctcttccttctatgggagaactgacatca
aaactagagagtgaacttggtttcactgttagaggttgtgtattaggccatacacaaaga
ggagctattccaacttcctgagaactatttgtttcttctcaatttggtcgaaaagctttt
gaagctttcgactctaaagaatttgatattgctatagggtttaatggaactagcttttat
aagacttcaattgataagctagatagttcttcaaaaggagatagactatctcttattgaa
gaaaaaaatagcttagtttcctag

DBGET integrated database retrieval system