KEGG   Mycoplasma suis KI3806: Msui07360Help
Entry
Msui07360         CDS       T01442                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msk  Mycoplasma suis KI3806
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Msui07360 (ruvA)
Enzymes [BR:msk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Msui07360 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620242..620862
Genome map
AA seq 206 aa AA seqDB search
MYYLKCQIISVHKNYLIAESNGKGYKINFADTYSIKEQEEHLIYVFREFKLDTKNQITSQ
LFGFLSEKEFELFNSLLAIKGIGCKTAQAILTNDWNMMYFLAEREERLKLAELRGFNLKI
ANLFIYSIKNMKSLKNSFNKHSSSSYSDSKECKEKEVISSLIKIGYKFDDIKRALDIIRE
SDTELKNDFNSLINECLKTISQIKYH
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtactacttaaagtgtcaaattatctcagtgcacaaaaattatttaattgctgaaagt
aatggaaagggttacaaaataaactttgctgatacttattccattaaggagcaagaagag
catttaatttatgtgttccgagaatttaagctagacactaaaaatcaaataacttcccaa
ttatttggttttctttctgaaaaagaatttgaattatttaacagtctattggcgataaaa
ggaataggttgtaaaacagctcaagccatattaactaatgactgaaatatgatgtacttc
ttggcagaacgtgaagaaagactaaaactagctgaactaaggggattcaatctgaaaata
gctaatttatttatctactcaataaaaaatatgaagtcactaaaaaattcttttaataaa
cattcttcatccagttattctgattccaaagaatgtaaagagaaggaagttatttcttct
ctaataaaaattggatacaaatttgatgacataaaaagagctctagacattattagagaa
agcgatactgaattgaagaatgacttcaattcgctaattaatgaatgtttaaaaacaata
tctcaaatcaaatatcactag

DBGET integrated database retrieval system