KEGG   Methylocella silvestris: Msil_0011Help
Entry
Msil_0011         CDS       T00802                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
msl  Methylocella silvestris
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Msil_0011
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Msil_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(10032..10430)
Genome map
AA seq 132 aa AA seqDB search
MNFRYASIIAALAFMGPTAAAYAADAAAGETLFKQKCAVCHKIGEGAKNFVGPELNGIIG
RVAGAGSAGYSYSDGLKASGITWDSDKLHAWLTNPKALVPGTKMIFAGLPKEEDRDNVVA
FLSQFDADGKKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcagatatgcttcgatcatcgcggcgcttgctttcatgggccccacagcggcc
gcctacgccgccgacgccgcggcgggggaaaccctcttcaagcagaaatgcgccgtttgc
cataagattggcgaaggggccaagaattttgtcggtcctgagctcaatggcatcatcggc
cgcgtcgccggcgcgggatctgcaggatattcctattccgacggcctcaaggcctcgggc
atcacctgggattcggacaagctgcacgcttggctgaccaacccgaaagcgctggtcccc
ggcaccaagatgatcttcgccggcctcccgaaggaagaagaccgcgacaatgtcgtcgca
ttcttgtcgcaattcgacgccgacggaaagaaaaaataa

DBGET integrated database retrieval system