KEGG   Methylocella silvestris: Msil_0147Help
Entry
Msil_0147         CDS       T00802                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msl  Methylocella silvestris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msil_0147
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msil_0147
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msil_0147
Enzymes [BR:msl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msil_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
142460..143713
Genome map
AA seq 417 aa AA seqDB search
MSQAFVAQNLNSYRTGPDERGHFGVFGGRFVAETLMPLILDLERHYEAARSDPAFKAELD
NLLTHYVGRPSPLYYAERMTEFFRRKAADAGSEGGAKIYFKREDLNHTGAHKINNVLGQI
LLARRMGKTRIIAETGAGQHGVATATACARFGLDCVVYMGSVDVERQKPNVFRMKLLGAK
VVPVESGARTLKDAMNEALRDWVTNVADTFYCIGTAAGPHPYPAMVRDFQCIIGDETRRQ
MREAEGRLPDSLLACIGGGSNAIGLFHPFLDDPSVEIYGVEAAGFGLDDKHAASLAGGRP
GVLHGNRTYLLMNADGQIEEGHSISAGLDYPGIGPEHSWLKESGRVTYLSATDAEALAAF
EQCSKLEGIIPALEPAHALAKVGDIAPLKPQDHLMVVNISGRGDKDIFTVAEHLGGM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggcttttgttgcgcaaaacctcaattcctatcgcaccggccccgacgagcgc
ggccattttggcgtctttggcggccgcttcgtcgccgaaaccctgatgccgctgattctc
gacctcgagcgtcactatgaggccgcacgatccgatcccgccttcaaggccgaactcgat
aatctccttacccattacgtcggccggccgagcccgctctattatgccgagcgcatgacc
gagttttttcgacgcaaagcggccgacgccggaagcgagggcggcgcaaaaatctacttc
aagcgcgaggatctgaaccacaccggcgcgcataagatcaacaatgtgctcgggcagatt
ctgctggcgcggcgcatgggcaagacgcgcattatcgccgagacgggcgccggccagcat
ggcgtcgcgaccgccaccgcctgcgcgcgcttcgggctcgattgcgtcgtctatatggga
tcggtcgacgtcgagcggcaaaagcccaatgtgtttcgcatgaaactgctcggcgccaag
gtcgtgccggtggaatcgggcgcgaggacgctgaaggacgccatgaacgaggcgctgcgc
gactgggtcaccaatgtcgccgatactttttattgcatcggcaccgcggcggggccgcat
ccctatcccgcgatggtgcgcgatttccaatgcatcatcggcgatgagacgaggcgtcag
atgcgcgaggccgagggccgcctgccggattccttgctggcgtgcatcggcggcggctcg
aacgccatcggcctgtttcaccctttcctcgacgatccgtcggttgagatttacggggtg
gaggcggcgggttttggccttgatgacaagcacgccgcctcgctcgcgggcgggcgcccc
ggcgtgctgcacggcaatcgcacctatctcctgatgaatgcggacggccagatcgaggaa
ggccattcgatctcggccggcctcgactatccgggcatcggccccgaacattcctggctg
aaggaatccggcagagtgacctatctgtccgcgaccgacgcggaagcgctggccgccttc
gagcaatgctcgaagcttgagggcatcatcccggcgctggagccggcccatgcgctggcc
aaggtcggcgacatcgcgccgttgaagccgcaggatcatctgatggtggtgaatatttcc
ggccgcggggacaaggatattttcaccgtcgccgaacacctcggcgggatgtaa

DBGET integrated database retrieval system