KEGG   Methylocella silvestris: Msil_0161Help
Entry
Msil_0161         CDS       T00802                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
msl  Methylocella silvestris
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msil_0161
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msil_0161
   00052 Galactose metabolism
    Msil_0161
   00500 Starch and sucrose metabolism
    Msil_0161
   00520 Amino sugar and nucleotide sugar metabolism
    Msil_0161
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msil_0161
   00524 Butirosin and neomycin biosynthesis
    Msil_0161
Enzymes [BR:msl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Msil_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(157399..158430)
Genome map
AA seq 343 aa AA seqDB search
MTHAPVEKGVRLDFPFPIMLCDIGGTNARFALKSAPGAPLLPGPPIKTADYSCFEAALST
AFVGFAVKPRSVIACAAGPISGRSAKLTNAAWEIDGAAIARELSLDQGLLLNDFEAQALT
LPVLEHDWTTHIGPPVEAAPGVRLVIGVGTGLGAAALVEVEGRYLALASEAGHVDFAPVG
AVEAAIWPHIRMSDQGRISAETILSGHGIARLHQARCAAAGLPPPTLDEIGVVREALAAP
DGEEARTLGLFWVLVARCAGDLTLNLLAKGGVIFSGGVLPRLTAFLDPAQFRARFEDKAP
FGEMMQQIGTRLVIANEVVLPGLAAIAVDPDRYIIDYAARAWR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgctccagtggagaaaggcgttcgcttggattttcctttcccgatcatgctg
tgcgacatcggcgggacgaacgcccgattcgccctgaaatcggcgcccggcgcccctctt
ttgccgggaccgccgatcaaaacggcggattattcgtgcttcgaggcggctctttcgact
gctttcgtcggttttgcagtaaagccgcgatcggtgatcgcctgcgcggcgggtccgatt
tccggacgcagcgccaagttgacgaacgccgcctgggagatcgacggagcggccatcgcg
cgagaattgtcgctcgaccaagggctgctcctcaatgattttgaggcgcaggccttgacg
ctccccgtgctggagcatgactggacgacgcatatcgggcccccggtcgaggccgcgccc
ggcgtccgtctggtcatcggcgtcggcaccggcctcggggcggccgcgctcgtcgaggtc
gaaggccgctatcttgccctcgcaagcgaagccggacatgtcgattttgcgccggtcggc
gcggtggaggccgcgatctggccgcatatccgcatgtccgaccagggccggatcagcgcc
gagacgatcctgtcgggtcatggcattgcgaggctacatcaggcgcgctgcgccgcggcc
ggcctgccgccgccgacgctcgacgagatcggcgtcgttcgagaagcgctggccgcgccg
gacggcgaggaggcccgcacgctggggctgttctgggtgcttgttgcgcgctgcgccggc
gacctgacgctcaatctgctggccaaggggggcgtcattttttcaggcggagtgctgccg
cgcctcaccgcttttctcgatccggcgcagtttcgcgcccgcttcgaggacaaggcgccg
ttcggcgaaatgatgcagcagatcggaacccgcttggtcatcgccaatgaggtggtgctg
ccaggactggcggcaatcgccgtcgatccggaccgttacatcatcgactatgcggcgcgc
gcctggcgatga

DBGET integrated database retrieval system