KEGG   Methylocella silvestris: Msil_0161Help
Entry
Msil_0161         CDS       T00802                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
msl  Methylocella silvestris
Pathway
msl00010  Glycolysis / Gluconeogenesis
msl00052  Galactose metabolism
msl00500  Starch and sucrose metabolism
msl00520  Amino sugar and nucleotide sugar metabolism
msl00521  Streptomycin biosynthesis
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01120  Microbial metabolism in diverse environments
msl01130  Biosynthesis of antibiotics
msl01200  Carbon metabolism
Module
msl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msil_0161
   00052 Galactose metabolism
    Msil_0161
   00500 Starch and sucrose metabolism
    Msil_0161
   00520 Amino sugar and nucleotide sugar metabolism
    Msil_0161
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msil_0161
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Msil_0161
Enzymes [BR:msl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Msil_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACK49142
JGI: Msil0161
UniProt: B8EN07
Position
complement(157399..158430)
Genome map
AA seq 343 aa AA seqDB search
MTHAPVEKGVRLDFPFPIMLCDIGGTNARFALKSAPGAPLLPGPPIKTADYSCFEAALST
AFVGFAVKPRSVIACAAGPISGRSAKLTNAAWEIDGAAIARELSLDQGLLLNDFEAQALT
LPVLEHDWTTHIGPPVEAAPGVRLVIGVGTGLGAAALVEVEGRYLALASEAGHVDFAPVG
AVEAAIWPHIRMSDQGRISAETILSGHGIARLHQARCAAAGLPPPTLDEIGVVREALAAP
DGEEARTLGLFWVLVARCAGDLTLNLLAKGGVIFSGGVLPRLTAFLDPAQFRARFEDKAP
FGEMMQQIGTRLVIANEVVLPGLAAIAVDPDRYIIDYAARAWR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgctccagtggagaaaggcgttcgcttggattttcctttcccgatcatgctg
tgcgacatcggcgggacgaacgcccgattcgccctgaaatcggcgcccggcgcccctctt
ttgccgggaccgccgatcaaaacggcggattattcgtgcttcgaggcggctctttcgact
gctttcgtcggttttgcagtaaagccgcgatcggtgatcgcctgcgcggcgggtccgatt
tccggacgcagcgccaagttgacgaacgccgcctgggagatcgacggagcggccatcgcg
cgagaattgtcgctcgaccaagggctgctcctcaatgattttgaggcgcaggccttgacg
ctccccgtgctggagcatgactggacgacgcatatcgggcccccggtcgaggccgcgccc
ggcgtccgtctggtcatcggcgtcggcaccggcctcggggcggccgcgctcgtcgaggtc
gaaggccgctatcttgccctcgcaagcgaagccggacatgtcgattttgcgccggtcggc
gcggtggaggccgcgatctggccgcatatccgcatgtccgaccagggccggatcagcgcc
gagacgatcctgtcgggtcatggcattgcgaggctacatcaggcgcgctgcgccgcggcc
ggcctgccgccgccgacgctcgacgagatcggcgtcgttcgagaagcgctggccgcgccg
gacggcgaggaggcccgcacgctggggctgttctgggtgcttgttgcgcgctgcgccggc
gacctgacgctcaatctgctggccaaggggggcgtcattttttcaggcggagtgctgccg
cgcctcaccgcttttctcgatccggcgcagtttcgcgcccgcttcgaggacaaggcgccg
ttcggcgaaatgatgcagcagatcggaacccgcttggtcatcgccaatgaggtggtgctg
ccaggactggcggcaatcgccgtcgatccggaccgttacatcatcgactatgcggcgcgc
gcctggcgatga

DBGET integrated database retrieval system