KEGG   Methylocella silvestris: Msil_0276Help
Entry
Msil_0276         CDS       T00802                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
msl  Methylocella silvestris
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:msl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
319207..319812
Genome map
AA seq 201 aa AA seqDB search
MGDRICGPEIERLIQLLARLPGLGPRSARRAALHLIRKREELFGPLAEAMRVARDTIVSC
SVCGNVDSCDPCTICRDERRDPSTLIVVETVGDLWALERSGAVKGRYHVLGGVLSPLDGV
GPKDLNISSLIERVAAGGISEVVLAVNATVDGQTTAHYVTDLISHLNVRTTRLAHGVPVG
GELDYLDEGTLAAALRARTDF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatcgcatttgcggtcccgagattgaacgtctcatccagctgctggcgcggctg
ccgggccttggtccgcgttcggcgcggcgcgcggcgctgcatctcatccgcaagcgtgag
gaattgtttgggccgctcgcggaggcgatgcgcgtcgcccgcgacacgatcgtttcgtgt
tcggtctgtggcaatgtcgacagctgtgatccttgcaccatctgccgcgacgagcggcgc
gatccctcgacgctgattgtcgtcgagaccgtcggcgatctctgggcgctggagcgctcc
ggcgccgtcaaggggcgctatcacgtgctcggcggcgtcctgtcgccgctcgacggcgtc
ggccccaaggatctcaacatttcaagcctaatcgagcgggtcgccgccggcggaatttca
gaagtcgttctggcggtcaacgccaccgtcgatggccagacgacggcgcattatgtgacg
gatctcatctctcatcttaatgtgcgcaccacccgtctcgcgcatggcgttccggtcggc
ggcgaactcgactatctcgacgaaggcacgctggcggcggctctccgcgcgcggacggat
ttttag

DBGET integrated database retrieval system