KEGG   Methylocella silvestris: Msil_0405Help
Entry
Msil_0405         CDS       T00802                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
msl  Methylocella silvestris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Msil_0405
Enzymes [BR:msl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Msil_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(442505..443938)
Genome map
AA seq 477 aa AA seqDB search
MSAPFKQQASLDVWMRRQYGLSAAKMMSAISRVDLVKERRGFGRLLRPAKGSILASPVIA
AYDPDPDYFFHWLRDSAVIIDALRLLIESEEIARPEGLAHFSDFLGFSLTLCGLDGRSFL
AGAGDYRAKVEPHFAQFLRPEADLLAISGDDILGEPRFDPDGSIDILKWSRPQHDGPALR
VLAVARFCQSVGPGPDIFKQAEELIIRDLGFTFARWRAPSFDIWEEELGRHYYTQLVQCE
ALREGGLWLESRGAIESATAYLDASQEIAAGLDDFWSAPQGFVRSRIAAAGSGPQKELDI
ATVLAVIHAGREAGAHSVCDSRLIATLGRLEALFADAYTINTTQPGADAPAMGRYDGDRY
YSGGAYFFSTLGAAEFHFKAAQAVAKGFLHDASEWARIGLDSKHDGHHLFEALLRCGDLF
MTTVAAYTSENGDLSEQFDQTTGVQTSAKNLAWSHAAFISAYASREKALRSAKGVSP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccttcaaacaacaggcgtcgctcgatgtctggatgcgccgtcaatatggg
ctttccgccgcgaaaatgatgagcgccatttcacgggtcgacctcgtcaaggagcggcgc
ggttttggacggctgttgcggccggcgaaaggctcgatcctcgcttcgcccgtgatcgcc
gcctatgatccggaccccgactatttcttccactggctgcgcgattctgccgttatcatt
gacgccttgcggctgttgatcgagagcgaggaaatcgcgcggcccgagggccttgcgcat
ttttccgatttcctcggcttcagcctgacgctgtgcggtctcgacgggcgctcatttctg
gcgggagccggcgattaccgggcgaaggtcgagcctcatttcgcgcaatttctgcggccc
gaggcggatcttctcgccatctcaggcgacgatatcttgggcgaaccgagattcgatccc
gacggttcgatcgacatcctgaaatggtcgcggccgcaacatgatgggccggccctgcgc
gtgctcgcggtcgcccgattctgccagtcggtcggcccggggccggacattttcaagcag
gcggaagagctcatcatccgcgatctcggcttcaccttcgcccgctggcgcgcgccatct
ttcgatatctgggaggaagagctcgggcgccactattatacgcagctcgtccaatgcgag
gcgttgcgcgagggcggcttatggctcgagtcgcgcggcgcaatcgagagcgccaccgca
tatcttgacgcatcgcaggagatcgccgcgggcctcgacgacttctggagcgcgccgcaa
ggttttgtacgaagccgcatcgccgcggcgggctccggcccgcaaaaggagctcgacatc
gcgaccgtgctcgctgtgatccacgccgggcgcgaggctggcgcgcatagcgtgtgcgac
tcgagactgattgcgacgcttggccggctcgaagcgcttttcgccgatgcctatacaatc
aacacgacacaaccgggcgcagacgccccggcaatgggccgctatgacggcgatcgctac
tacagcggcggcgcctattttttctcgacgctcggcgcggcagaattccatttcaaagcg
gcgcaggccgtggcgaagggtttcctccacgacgcctcggaatgggcgcgcatcgggctc
gattcaaaacatgacggtcatcatctctttgaggcgctcctgcggtgcggcgatctgttc
atgacgacggtcgccgcctacacgtcggagaacggcgacctctccgaacaattcgatcaa
acgactggcgtccagacatcggctaaaaatctcgcctggagccacgccgctttcatcagc
gcctacgccagccgggagaaggcgcttcgttccgccaaaggcgtctcgccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system