KEGG   Methylocella silvestris: Msil_0420Help
Entry
Msil_0420         CDS       T00802                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
msl  Methylocella silvestris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msil_0420
Enzymes [BR:msl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Msil_0420
Exosome [BR:msl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Msil_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(461843..462934)
Genome map
AA seq 363 aa AA seqDB search
MIWPLNSKPKQFPADEGAAAAAARALAPDGDAPAPLPGPTVRLRRNRKAEWTRRLVRENV
LTANDLIWPIFVREGVNQHEAIASMPGVERLSIDAAVESAREAHALGVPAIALFPYTDPA
LRDAAGTEALNPDNLICRAVRAIKETTPEIGLITDVALDPYTSHGHDGLMRGEEILNDET
VEVLVKQALNFARAGADMIAPSDMMDGRVGAIRRGLDAEGFTSVQVLAYAAKYASAFYGP
FRDAVGTQKTLIGDKRTYQMDPANSDEALREVAQDIAEGADMVMVKPGLPYLDIIYRVKE
KFGLPTFAYQVSGEYAMIEGAARNGWLDGDRAIMESLLAFKRAGADAVLTYFAPRVARLL
RDE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatctggcccctcaattcaaaaccgaaacagtttccggccgatgagggcgctgccgcg
gccgcggcgcgcgccctcgccccggacggcgatgctcctgcgcccctgcccggcccgacg
gtgcgcctgcgccgcaaccgcaaggcggagtggacgcgccgcctcgtccgcgaaaatgtc
ctgaccgccaatgatctgatctggccgattttcgtgcgcgagggagtcaatcagcatgag
gcgatcgcctccatgccgggcgtcgagcgcctctcgatcgacgccgccgtcgaaagcgcg
cgcgaggcgcatgcccttggcgtgccggcgatcgcgctgtttccctataccgaccccgcg
cttcgcgacgccgccgggaccgaggcgctgaacccggacaatctgatctgccgcgctgtc
cgggcgatcaaagaaacgacgccggagatcggcctcatcaccgacgtcgcgctcgatccc
tacaccagccatggccatgacggcctgatgcgcggcgaggaaattctcaacgatgagacg
gtcgaggttctggtcaaacaggcgctgaatttcgcgcgcgcgggcgccgacatgatcgcc
ccctcggacatgatggacgggcgcgtcggcgcgataaggcgcgggctcgacgcggaggga
tttacctccgttcaggtgctggcctatgccgctaaatatgcctcggccttctacggcccg
ttccgcgacgccgtcggcacgcagaagacgctcattggcgacaagcgcacctatcagatg
gacccggccaattcggatgaagcgctgcgcgaggtggcgcaggatattgccgagggcgcc
gacatggtgatggtgaagcccggcctgccctatctcgacatcatctatcgcgtgaaggaa
aaattcggcctgccgaccttcgcctatcaggtgtcgggcgaatacgcgatgatcgaaggc
gcggcgcgcaatggctggctcgacggcgaccgcgcgattatggagagcttgctcgctttc
aagcgcgccggcgccgacgccgtgctgacctatttcgccccgcgcgtggcgcggctgctg
cgggacgagtaa

DBGET integrated database retrieval system