KEGG   Methylocella silvestris: Msil_0508Help
Entry
Msil_0508         CDS       T00802                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msl  Methylocella silvestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msil_0508
   01230 Biosynthesis of amino acids
    Msil_0508
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msil_0508
   00051 Fructose and mannose metabolism
    Msil_0508
   00562 Inositol phosphate metabolism
    Msil_0508
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Msil_0508
Enzymes [BR:msl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msil_0508
Exosome [BR:msl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msil_0508
  Exosomal proteins of bladder cancer cells
   Msil_0508
  Exosomal proteins of melanoma cells
   Msil_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
565633..566424
Genome map
AA seq 263 aa AA seqDB search
MTNGPSRSERRPLVAGNWKMNGLRKDLVEAEKICVAAAAGEAGEAEVVICLPATLLISAA
PACHAAGVGLGGQHCHGEPKGPFTGDLSAEMLRDAGASYVILGHSERRAGHNEGNAAVRE
KTRGAFRAGLTAIVCVGETRGQREAGDALPIVGSQLTGSIPGEATPQNLVIAYEPVWAIG
TGLTPTLRDIAEMHRFIRERVGVDLPRIRDGIRILYGGSVKPNNAADLMRVPNVDGALVG
GASLTAKDFMGIAGVYRDYCLAS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgggccctcgcggtcggaacggcgccccctcgtcgccggtaactggaaaatg
aacggtctgcgcaaggatctcgtcgaggccgagaagatttgcgtggccgcggcggccggc
gaagccggtgaggccgaggtcgtgatctgtctgccggcgactttgttgatttccgcggcg
cccgcctgccatgcggcgggagtcgggctcggcggccagcattgccatggggagccgaag
gggccctttactggcgatctctcggcggaaatgctgagggacgccggcgcctcctatgtc
attcttggccattccgagcgcagggccggccacaatgaaggcaacgccgccgtccgcgaa
aaaacccgcggcgccttcagggcgggactgaccgcgatcgtctgcgtcggcgagacccgc
ggccagcgcgaggcgggcgacgccctgccgatcgtcggctcgcagctgaccggctcgatt
cccggcgaggcgacgccgcaaaacctcgtgatcgcctatgagccggtctgggcgatcggc
acaggcctgacgccgacgctcagagatatcgccgagatgcaccgattcatccgcgagcgg
gtcggcgtcgatctgccgcgcattcgtgatgggatccgcatcctttatggcggctccgtc
aagccgaacaatgcggccgatcttatgcgcgtcccgaatgtcgatggcgccctcgtcggc
ggcgccagtctgaccgccaaggattttatggggatcgcaggcgtttatcgcgactattgc
ctggcgtcctaa

DBGET integrated database retrieval system