KEGG   Methylocella silvestris: Msil_0508Help
Entry
Msil_0508         CDS       T00802                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msl  Methylocella silvestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:msl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:msl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:msl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:msl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:msl00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:msl00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
565633..566424
Genome map
AA seq 263 aa AA seqDB search
MTNGPSRSERRPLVAGNWKMNGLRKDLVEAEKICVAAAAGEAGEAEVVICLPATLLISAA
PACHAAGVGLGGQHCHGEPKGPFTGDLSAEMLRDAGASYVILGHSERRAGHNEGNAAVRE
KTRGAFRAGLTAIVCVGETRGQREAGDALPIVGSQLTGSIPGEATPQNLVIAYEPVWAIG
TGLTPTLRDIAEMHRFIRERVGVDLPRIRDGIRILYGGSVKPNNAADLMRVPNVDGALVG
GASLTAKDFMGIAGVYRDYCLAS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgggccctcgcggtcggaacggcgccccctcgtcgccggtaactggaaaatg
aacggtctgcgcaaggatctcgtcgaggccgagaagatttgcgtggccgcggcggccggc
gaagccggtgaggccgaggtcgtgatctgtctgccggcgactttgttgatttccgcggcg
cccgcctgccatgcggcgggagtcgggctcggcggccagcattgccatggggagccgaag
gggccctttactggcgatctctcggcggaaatgctgagggacgccggcgcctcctatgtc
attcttggccattccgagcgcagggccggccacaatgaaggcaacgccgccgtccgcgaa
aaaacccgcggcgccttcagggcgggactgaccgcgatcgtctgcgtcggcgagacccgc
ggccagcgcgaggcgggcgacgccctgccgatcgtcggctcgcagctgaccggctcgatt
cccggcgaggcgacgccgcaaaacctcgtgatcgcctatgagccggtctgggcgatcggc
acaggcctgacgccgacgctcagagatatcgccgagatgcaccgattcatccgcgagcgg
gtcggcgtcgatctgccgcgcattcgtgatgggatccgcatcctttatggcggctccgtc
aagccgaacaatgcggccgatcttatgcgcgtcccgaatgtcgatggcgccctcgtcggc
ggcgccagtctgaccgccaaggattttatggggatcgcaggcgtttatcgcgactattgc
ctggcgtcctaa

DBGET integrated database retrieval system