KEGG   Methylocella silvestris: Msil_0521Help
Entry
Msil_0521         CDS       T00802                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msl  Methylocella silvestris
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msil_0521
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msil_0521
   00020 Citrate cycle (TCA cycle)
    Msil_0521
   00620 Pyruvate metabolism
    Msil_0521
Enzymes [BR:msl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Msil_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
579286..580620
Genome map
AA seq 444 aa AA seqDB search
MPVNILMPALSPTMEKGNLSRWLKKEGDKIKSGDVIAEIETDKATMEVEAVDEGVLARIV
VPDGTADVAVNDVIGVIAADGEDVSAAAAPAAAKPAPAAPASAAPASAPSAPAASAAQTA
PAPAAVNGQAGPRLFASPLARRIAKESGLDLSGVAGSGPHGRIVERDVKAALAQPRPQIA
KAPAAPAAPSPAAPTPAPASDEAIRKFYAPGSYDEAPHDSMRKTIARRLVEASQTIPHFY
LSVDCNLDALLALRETVNAQASRDKDAKPSYKISVNDFIIKGLALALIRVPEANVTWTES
VMLKHKHADVGVAVSIPGGLITPVIRSADTKSLSAISNEMKDYAARAKARKLKPEEYQGG
SSSVSNLGMFGIKNFSAIINPPQSSILAVGAGEKRVVVKDGAPAVATLMSVTLSTDHRAV
DGALGAELLDAFKSLIEHPMSMLV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcaacatcctgatgcccgccctttcgccgaccatggaaaaaggcaatctcagc
cgatggttgaagaaagaaggcgacaagatcaaatccggcgacgtcatcgctgaaatcgag
accgacaaggcgacgatggaggtcgaggcggtggacgaaggcgttctcgccaggatcgtc
gtccccgatggcaccgccgacgtcgccgtgaacgacgtgatcggggtcatcgccgccgat
ggagaggacgtatcggccgccgcggcccctgccgccgccaaacccgcgcccgcggcgccc
gcgtctgccgcgccagcttccgccccgtccgcgcccgctgcatccgcagcgcaaacggct
ccggcgcccgccgccgtcaacgggcaggcggggccgcgcctgttcgcctcgccgctcgcg
cgccgcatcgccaaggagtcggggctcgatctctccggcgtcgccggctcaggtccgcat
ggccgcatcgtcgagcgcgacgtcaaggcggcgctggcccagccaagaccgcaaatcgcc
aaggcgccggcggcgcccgccgcgccgtctccggccgcgccgactcccgccccggcgtcg
gatgaagccatccgcaaattctatgcgccaggctcctatgacgaggcgccgcatgattca
atgcgcaagacaattgcgaggcgccttgtcgaagcgagccagacgatcccgcatttctat
ctgtcggtcgactgcaatctcgacgctctgctggcgttgcgcgagacggtgaacgcgcag
gcctctcgcgacaaggacgccaagccctcttacaaaatctcggtcaatgatttcatcatc
aaggggctcgctctggcgttgatccgcgtgccggaagccaatgtcacctggaccgaatcg
gtcatgctgaagcacaagcatgccgatgtcggcgtcgccgtctcaattcctggcggcctc
atcacgccggttatccgttcggccgacacgaagtcgctgtcggcgatttcgaacgagatg
aaggattatgcggcgcgggccaaggcgcggaaactgaagccggaggaatatcagggcggc
tcctcctcggtgtcgaacctcggcatgttcggcatcaagaatttttccgccatcatcaac
cccccgcaatcctcgatcctcgcggtcggggcgggcgagaagcgcgtcgtcgtcaaggac
ggcgcgccggcggtggcgacgttgatgagcgtcacgctctcgaccgatcatcgcgcggtc
gatggggcgcttggcgccgagctgctcgacgccttcaaatccctgattgagcatccgatg
tcgatgctcgtttga

DBGET integrated database retrieval system