KEGG   Methylocella silvestris: Msil_0811Help
Entry
Msil_0811         CDS       T00802                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
msl  Methylocella silvestris
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:msl00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:msl00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(891589..892374)
Genome map
AA seq 261 aa AA seqDB search
MTLKSRNAIVTGSTSGIGLAIAREFAKDGANVTINGLGDAAAIEAERAKIEADFGVKAAY
SPANMTKPEEIRAMVTDAEKAFGSVDILVNNAGIQHVAPIEDFPIDTWNLIIAINLSAAF
HAIAAAIPGMKARKWGRIISTASAHSKVASPFKSAYVSAKHGIDGLTKTAALELATFGVT
VNCISPGYVWTPLVEKQIPDTMASRHLTREQVINDVLLTAQPTKQFVTVDQVAALAAFLC
TDAASQITGSNISIDGGWTAE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacccttaaatcccgcaacgccatcgtcaccgggtcgaccagcggcatcgggctcgcc
atcgcccgcgaattcgccaaggacggcgccaatgtcaccatcaacggcctcggcgatgcg
gcggcgatagaggccgaacgcgccaagatcgaagcggatttcggcgtcaaggcggcctat
tcgccggccaatatgaccaagccggaagaaatccgcgccatggtgacggacgccgaaaaa
gcttttggcagcgtcgatattctcgtcaacaacgccgggatccagcatgtcgcgccgatc
gaggattttccgatcgatacctggaacctcatcatcgcgatcaatctgtccgccgctttc
cacgccatcgccgcagccattcccggcatgaaggcgcgcaaatggggccgcatcatctcg
accgcctcggcccattccaaggtcgcctcgccgttcaaatccgcctatgttagcgccaag
cacggcatcgacgggctgaccaagacggcggcgctggagctcgcgaccttcggcgtcacg
gtaaattgcatctctcccggctatgtctggacgcctctggtcgaaaagcagatccccgac
accatggcctcgcgccatctgacgcgcgaacaggtcatcaatgacgttctcctgacggcg
cagccgaccaagcagttcgtgaccgtcgatcaggtggcggcgctggcggcgttcctctgc
acagacgcggcctcgcagatcaccggctcgaatatttcgatcgacggcggatggacggcc
gaatga

DBGET integrated database retrieval system