KEGG   Methylocella silvestris: Msil_0903Help
Entry
Msil_0903         CDS       T00802                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msl  Methylocella silvestris
Pathway
msl00071  Fatty acid degradation
msl00280  Valine, leucine and isoleucine degradation
msl00281  Geraniol degradation
msl00310  Lysine degradation
msl00360  Phenylalanine metabolism
msl00362  Benzoate degradation
msl00380  Tryptophan metabolism
msl00410  beta-Alanine metabolism
msl00627  Aminobenzoate degradation
msl00640  Propanoate metabolism
msl00650  Butanoate metabolism
msl00903  Limonene and pinene degradation
msl00930  Caprolactam degradation
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01120  Microbial metabolism in diverse environments
msl01130  Biosynthesis of antibiotics
msl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Msil_0903
   00650 Butanoate metabolism
    Msil_0903
  Lipid metabolism
   00071 Fatty acid degradation
    Msil_0903
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Msil_0903
   00310 Lysine degradation
    Msil_0903
   00360 Phenylalanine metabolism
    Msil_0903
   00380 Tryptophan metabolism
    Msil_0903
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Msil_0903
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Msil_0903
   00281 Geraniol degradation
    Msil_0903
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Msil_0903
   00627 Aminobenzoate degradation
    Msil_0903
   00930 Caprolactam degradation
    Msil_0903
Enzymes [BR:msl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Msil_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Arg_repressor_C
Motif
Other DBs
NCBI-ProteinID: ACK49873
JGI: Msil0903
UniProt: B8ESI3
Position
complement(988640..989692)
Genome map
AA seq 350 aa AA seqDB search
MVEDVIIETRGACGLITLNRPAALNSLNIGMAQAIAAALDRWRTDAAVGCVAIRGAGGRA
FCAGADIRALYELGKSGRGDEQLAFFRQEYRLDQSIARYPKPVVALIDGIVMGGGVGLSV
HAAHCVAGDNVTFAMPEVGIGFFPDVGATYFLPRLPGAIGAFLALTGARIGSGDVLALKL
ASAYVPTARHDALAERLAKGEEPAAAIAAEAADPPESAFIKERGWIDRCFKARTAAAIAQ
RLGNEQSGFAASCLAALASKSPTSLAIALRQVEIGAGLDLEEALRVEFRIAARILAGHDY
YEGVRATIIDKDQRPKWSPADLAAVDPADVEAYFAPLADELEFSAPAHAG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagacgtcatcattgaaacccgcggggcctgcggactgatcaccctcaatcgg
ccggccgcgctgaattcattgaatatcggcatggcccaggcgattgccgccgcgctcgat
cgctggcggacagacgcggcggtcggatgcgtcgcgatcaggggagcgggcgggcgcgcc
ttttgcgccggggccgatattcgcgccctttatgaactcggcaagagcgggcgaggcgac
gaacagctcgctttcttccgtcaggaataccgtctcgatcaaagcatcgcgcgctatccc
aagcccgtcgtcgcactgatcgacggcattgtcatgggcggaggggtcgggctctccgtg
cacgccgctcattgcgtcgccggcgacaatgtcactttcgccatgcccgaagtcggcatc
gggtttttcccggacgtcggcgcgacctattttcttccgcgcctgccgggcgccatcggc
gcctttctcgccctgaccggcgcgcggatcggctccggcgacgtgctggcgctaaaactc
gcctcggcctatgtccccacagcccgccacgatgcgctggcggagcggctcgcgaagggg
gaagagccagcggctgcgatcgcggcggaagcggcagatccgccggagtccgccttcatc
aaagagcgcggctggatcgatcgctgcttcaaggcgaggacggccgcggcgatcgcgcag
cggcttggcaacgaacaatcgggttttgccgcctcatgcctcgccgcgctcgcctcgaag
tcgccgacgagcctcgccatcgccttgcgtcaggttgagatcggcgccggtctcgatctc
gaagaggcgctgcgcgtcgaattccgcatcgccgcgcgcattcttgccggccatgattat
tatgagggcgtgcgggcgacgatcatcgacaaggatcagcggccgaaatggtcgcccgcc
gaccttgcagcagtcgacccggcagatgttgaggcctatttcgccccgctcgccgatgag
ctcgaattctccgcgccggcgcacgccggatga

DBGET integrated database retrieval system