KEGG   Methylocella silvestris: Msil_1021Help
Entry
Msil_1021         CDS       T00802                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
msl  Methylocella silvestris
Pathway
msl00300  Lysine biosynthesis
msl01100  Metabolic pathways
msl01120  Microbial metabolism in diverse environments
msl01230  Biosynthesis of amino acids
Module
msl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Msil_1021
Enzymes [BR:msl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Msil_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ACK49990
JGI: Msil1021
UniProt: B8ELJ6
Position
complement(1107758..1108924)
Genome map
AA seq 388 aa AA seqDB search
MSDLAHTAVELCRELLRRPSVTPLDAGAQDFLAAKLREAGFATHSVVFSDESTPDIQNLY
ARAGAGGRHLVFAGHTDVVPPGDSASWRFDPFGGEMEGGLIFGRGAVDMKGAIAAFAAAA
MAFVAEGGAQKGSISFLITGDEEGPAINGTDKLLRWAHQRGERFDHCILGEPTNQQALGD
MIKIGRRGSLNGTLTVKGVQGHVAYPHRAKNPIPHLMRLLAALTAEPLDQGTELFDASNL
EIVSVDVGNPTFNVIPAEARARFNIRFNDIWTPDALAAELRARAEKAGAAAGAASALHFE
PCNALAFVTQPDAFTDLVSAAIEQATGRKPKLSTSGGTSDARFIRAYCPVLEFGLVGSTM
HAVDERAPVEDISALASIYADILNSYFK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatctcgcccataccgccgtcgaattgtgccgcgagctgttgcggcgcccctct
gtgacgccgctcgacgccggcgcccaggactttctggcggcaaagcttcgcgaggccgga
tttgccacgcatagcgtcgttttctcggatgagagcacgcccgatattcaaaatctctac
gcccgcgccggcgccggcggccggcatctcgtcttcgccggacataccgacgtcgtgccg
ccgggagattcggcgagctggcgcttcgatccgttcggcggcgaaatggagggtggcctg
attttcggccgcggcgccgtggacatgaagggcgcgatcgccgctttcgccgccgccgcc
atggctttcgtcgccgagggcggcgcgcaaaaagggtcgatcagcttccttatcacgggc
gacgaggaaggtccggcgatcaacggcaccgacaagctgctgcgctgggcgcatcagcgc
ggcgagcgcttcgatcattgtattctcggcgagccgaccaaccagcaagcactcggcgac
atgatcaagatcggtcggcgcggttcgctgaacgggacgctgaccgtgaaaggcgtgcag
ggccatgtcgcctatccgcatcgcgccaaaaatcccattccacacctgatgcggctgctg
gcggcgctcacggcggagccgctcgaccagggcacggagctgttcgacgcctccaatctc
gaaatcgtcagcgtcgacgttggcaatccgaccttcaacgtcattccggccgaggcgcgg
gcgcgcttcaacatccgcttcaacgatatctggacgccggatgcgctcgcggccgagcta
cgcgcgcgcgccgagaaggcgggggcggcagcgggcgccgcttccgcgctccattttgaa
ccctgcaatgcgctggccttcgtgacgcagcccgacgcgtttaccgatcttgtcagcgcg
gcgatcgaacaggcgaccggacgcaaaccaaagctctcgacgagcgggggcacgtccgac
gcccggttcatccgcgcctactgccccgttctcgaattcggccttgtcggctcgaccatg
cacgccgtcgacgaacgcgcgccggtcgaggatatctctgcgcttgcgtcaatttacgca
gacatattgaattcttactttaagtag

DBGET integrated database retrieval system