KEGG   Methylocella silvestris: Msil_1122Help
Entry
Msil_1122         CDS       T00802                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
msl  Methylocella silvestris
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:msl00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1209154..1209819)
Genome map
AA seq 221 aa AA seqDB search
MEKRGEFAVRQSIIDGCLALARLGVNQGTAGNISVRWNGGLLITPSGLPYDEMGADDIVF
MAMDGSFRHPLAPSSEWRFHRDILARRPEVGAVVHAHPIFCTAFAMCRMEIPAAHYMIAA
AGGPTIRCARYESYGTPELSEAALEALEGRACTLLANHGMIATGPDLAEALWLAVETETL
ARQYAAALQIGAPVILDDAEIAKTVEKFKDYGLRGRNRRDG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagcgcggagaatttgcggtccggcaatcgatcatcgacggctgcctcgccctg
gcgcggctcggcgtcaatcaggggacggcgggcaatatttcggtccgctggaacggcgga
ctgctgatcacgccctccggtctgccttatgacgaaatgggcgccgacgacatcgtcttc
atggcgatggacgggtctttccgtcatccgctcgcgccttcgtccgagtggcggtttcac
cgcgatattttggcccgccgacccgaagtcggcgcggtggtccacgcccatccgatcttc
tgcacggctttcgccatgtgccggatggagattcccgccgctcattacatgatcgccgcg
gcgggcggcccaaccatccgctgcgcccgctatgagagctatggcacgccggaactgtcc
gaggcggcgctcgaggcgctcgagggccgcgcctgcacgcttctcgccaatcacggaatg
atcgcgacggggccggatctggctgaagctttatggctcgctgtggaaacggaaacgctc
gcccggcaatatgccgcagcgttgcaaatcggcgcgcctgtgattctcgacgatgcggag
atcgctaagacggtcgagaaattcaaggattacggcctgcgcgggcgaaacaggcgggac
ggctaa

DBGET integrated database retrieval system