KEGG   Methylocella silvestris: Msil_1251Help
Entry
Msil_1251         CDS       T00802                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
msl  Methylocella silvestris
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msil_1251
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msil_1251
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Msil_1251
Enzymes [BR:msl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Msil_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1344383..1345804
Genome map
AA seq 473 aa AA seqDB search
MKYVSTRGEAAPLSFTQTLLAGLAPDGGLYLPESYPRLDAERIASFSGKSYTDVTEAVIS
PFIGGEIVPAALRAMIDDAYAGFRHPAVAPLVQLDDNLFTLELFHGPTLAFKDLAMQLLA
RLVDHALKARGQRATVVGATSGDTGAAAIEAFSGLSQVEVFILYPHQRVSEVQRRQMTTT
GAPNVHAIAVEGSFDDAQSAVKALFNNRPLRESLNLCGVNSINWARILAQTVYYFTAAVA
LGAPHRPVSFVTPTGNFGDIFAGWIAKRMGLPIDRLVIAANSNDILPRALESGAYAVGEV
HATQSPSMDIQVSSNFERLLFEAQGRDGAAVRAWMAQLSQSRGFTIDPAPLKAIRADFDA
FSVSEPETTAEIARLWRESGYLADPHTAVGLGAARREIATRGAATPLVVLGTAHAAKFPD
AIEAATGVRPALPPHLHGLLERAEQFSIIPNDQGAVERFIRDAVAEQSAQAAS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatatgtctcaacacgcggcgaggctgctcctctatcgttcacgcagacgctgctc
gctggactcgcgccggacggcggcctctatctgcctgaatcctatccccgccttgacgcg
gaacgcatcgccagcttctcgggaaaatcctacaccgacgtcaccgaggcggtgatttcg
cccttcatcggcggcgagatcgtgcccgccgccctgcgcgccatgatcgacgacgcctat
gccggcttccgtcatccagcggtggcgccgctcgttcagctcgacgataatctgttcacg
ctcgagctgttccacggtccgacgctcgcgttcaaggatctggcgatgcagcttctggcg
cggctcgtcgatcacgccttaaaggcgcgcggccagcgcgccaccgtcgttggcgcgacc
tccggcgacacaggcgccgccgccatcgaggcattttccggcctgtctcaggtcgaagtc
ttcatcctctatccgcatcagcgcgtctcggaggtgcagcggcgccagatgacgacgacg
ggcgcgccaaacgtccacgccatcgccgtcgagggatcgttcgacgacgcgcaaagcgcg
gtcaaagcgttgttcaacaatcgcccgctacgcgaaagcctcaatctttgcggcgtcaat
tcgatcaactgggcgcgcatcctcgcccagaccgtctattacttcaccgccgccgtggcc
ctcggcgcgccccaccggccggtctccttcgtcacgccgacggggaatttcggcgacatc
ttcgccggctggatcgccaagcgcatgggtcttccgatcgaccggctggtgatcgccgcc
aattccaacgacattttgccgcgcgccttggagagcggagcctatgctgtgggcgaggtt
cacgcgacgcaatcgccctcgatggacattcaggtgtcgtcgaatttcgagcgcctcctg
ttcgaggcgcagggccgcgacggcgccgccgtccgcgcctggatggcgcagctgtcgcag
tcgcgcggcttcaccatcgatccggccccgctgaaggcgattcgggccgatttcgacgcc
ttctccgtcagtgagccggaaaccactgcggaaatcgcccggctctggcgcgaaagcggc
tatctcgccgatccgcacaccgccgtcggccttggcgccgcccgccgcgagatcgcgaca
aggggcgcagcgacgccgctcgtggtgctcggcaccgcccatgcggcgaaatttcccgac
gcgatcgaggccgcgactggcgtccggccggccttgccgccgcatcttcacggcttgctt
gagcgcgccgagcaattctcgatcattcccaacgatcagggcgccgtcgaacgcttcatc
cgcgacgcggtcgccgagcaatccgcacaggccgcctcatga

DBGET integrated database retrieval system