KEGG   Methylocella silvestris: Msil_1325Help
Entry
Msil_1325         CDS       T00802                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
msl  Methylocella silvestris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msil_1325
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Msil_1325
   00630 Glyoxylate and dicarboxylate metabolism
    Msil_1325
Enzymes [BR:msl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Msil_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1423900..1426065)
Genome map
AA seq 721 aa AA seqDB search
MAYAQIGPISVDTALRDFVETDVLPGTGVKADQFWTGLAGLIEDFAPRIRAQLRFRDELQ
SKIDAYHKIYAARSFDMAGYEAFLREIGYIVPEPPDFAIRTENTREVARVSGPQLVVPAS
NARFVLNAANARWGSLFDALYGSDVIPETPGAERGKGYNKARGARVIEYARNLLDELVPL
SKGSHKDVISYKVANGELVAELDNGLETRLKHPGRFAGWRRTGPGSFVVLLRQHGLHIEL
DIDPVSLVGSESKSGLADVILEAALSAIVDLEDSVAAVDAQDKVDVYRNWLGLMKGELSA
TLEKKGLLIERRLNPDRVYTDRDGAPMALHGRSLLLVRNVGHHVRTDAVLDADGHEVPET
IVDAAVTALIGMHDVKGAGPIHNSRSGSIYIVKPKMHGPDEVALANDLFGRVEDMLGLDR
FTLKMGIMDEERRTTVNLKACIFAAADRVFFINTGFLDRTGDEIHTSMEAGPMIRKDEIK
GTPWIAAYENNNVDIGLACGLPGRAQIGKGMWAAPDNMAEMVAKKIAHPLSGANTAWVPS
PTAATLHALHYHRVDVAMRQAELRKRPRAKLTDILTIPLAKTNWAPDDIKQEIENNCQGI
LGYVVRWVDQGIGCSKVPDVHDVALMEDRATLRISSQHIANWLRHDIVTKEQVLAALKTM
AVVVDRQNAGDPLYGPMAPNFDGPAFKAALDLIFKGREEPNGYTEGLLASWRREAKAMQA
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcgcagatcggaccgataagcgtcgacacggctttgcgggatttcgtcgag
accgacgtgctgccggggacaggcgtcaaggcggaccagttctggaccggccttgccggg
ctgatcgaggatttcgctccgcgcatccgggcgcaattgcgcttccgcgacgagcttcaa
tccaagatcgacgcctatcacaaaatctacgccgcaagatctttcgacatggccggctat
gaggcgttcctgcgcgagatcggctacattgtccccgagccgccggattttgccatccgc
accgaaaatacgcgcgaggtcgcgcgcgtctcgggtcctcagcttgtcgttcccgcctcg
aatgcgcgctttgttctcaacgcggccaacgcccgctggggcagcctgttcgacgcgctc
tacggctccgacgtcataccggaaacgccaggcgccgaacgcggcaagggctacaacaag
gcgcgcggcgcgcgcgtcattgaatatgcgcgcaacctgctcgacgagctggtcccgctg
tccaagggcagccacaaggacgtcatcagctacaaggtcgccaacggcgaactcgtcgcc
gaactcgacaatgggcttgagacgcggctgaagcatcctggccgtttcgccggctggcgg
aggactggccccggctcctttgtcgtgctgctgcgccagcacggcctgcacatcgaactc
gacattgatcccgtcagccttgtcggctcggaaagcaaatccggcctcgccgacgtcatt
ctcgaagcggcgctcagcgccatcgtcgaccttgaggacagcgtcgccgcggtcgacgcg
caggacaaggtcgacgtctatcgcaactggctcggcctgatgaagggcgaactgtcggcg
acgctcgagaagaagggcctgttgatcgaacggcggctcaatcccgaccgcgtctatacc
gatcgcgacggcgcccccatggccctgcacggacgcagcctgcttctcgtgcgtaatgtc
ggtcatcatgtgcgcaccgacgccgtgctcgatgcggacggtcatgaggttcccgagacc
atcgtcgacgccgccgtcaccgcgctgatcggcatgcatgacgtcaagggcgcgggtccg
atccacaacagccgcagcggctcgatctacatcgtcaaacccaagatgcacgggccggat
gaagtggctctcgccaatgatctgttcggccgggtcgaggatatgctgggcctcgatcgc
ttcacgctcaaaatgggcatcatggatgaggagcggcgcaccacggtcaatctgaaggcc
tgcatttttgccgccgccgaccgagtgttcttcatcaataccggcttcctcgatcgcacc
ggcgacgagatccacacctcgatggaggcgggtccgatgatccgcaaggatgagatcaag
gggacgccctggatcgcggcctatgaaaacaacaatgtggatatcgggctcgcctgcgga
ttgccgggccgagcgcagatcggcaagggcatgtgggctgcgcccgacaacatggccgaa
atggtcgccaagaaaatcgcccatccgctgtcgggcgccaacaccgcctgggtgccttcg
ccgaccgcggcgacgctgcatgcgctgcattaccatcgcgtcgacgtcgccatgcgtcag
gccgagctgcgcaagcgcccgcgcgccaagctcaccgatattctgacgatcccgctggcc
aagaccaattgggcgccggacgacatcaagcaggagatcgaaaacaactgccagggcatt
ttgggctatgtcgtgcgctgggtcgatcagggcatcggctgctccaaggtgccggacgtc
catgacgtcgccctgatggaggatcgcgcgacgctgcggatctcgagccagcacatcgcc
aactggctgcgccatgacatcgtgacgaaagagcaggtgctggccgcgttgaaaaccatg
gccgtcgtcgtcgaccggcagaatgcgggcgatccgctgtatgggccgatggcgccgaat
ttcgacgggccggcgtttaaggcggcgctcgatctcatcttcaagggccgcgaggagccg
aacggctacacggaagggttgctcgcctcctggcggcgcgaagcgaaagctatgcaggcg
tcctga

DBGET integrated database retrieval system