KEGG   Methylocella silvestris: Msil_1325Help
Entry
Msil_1325         CDS       T00802                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
msl  Methylocella silvestris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msil_1325
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Msil_1325
   00630 Glyoxylate and dicarboxylate metabolism
    Msil_1325
Enzymes [BR:msl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Msil_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1423900..1426065)
Genome map
AA seq 721 aa AA seqDB search
MAYAQIGPISVDTALRDFVETDVLPGTGVKADQFWTGLAGLIEDFAPRIRAQLRFRDELQ
SKIDAYHKIYAARSFDMAGYEAFLREIGYIVPEPPDFAIRTENTREVARVSGPQLVVPAS
NARFVLNAANARWGSLFDALYGSDVIPETPGAERGKGYNKARGARVIEYARNLLDELVPL
SKGSHKDVISYKVANGELVAELDNGLETRLKHPGRFAGWRRTGPGSFVVLLRQHGLHIEL
DIDPVSLVGSESKSGLADVILEAALSAIVDLEDSVAAVDAQDKVDVYRNWLGLMKGELSA
TLEKKGLLIERRLNPDRVYTDRDGAPMALHGRSLLLVRNVGHHVRTDAVLDADGHEVPET
IVDAAVTALIGMHDVKGAGPIHNSRSGSIYIVKPKMHGPDEVALANDLFGRVEDMLGLDR
FTLKMGIMDEERRTTVNLKACIFAAADRVFFINTGFLDRTGDEIHTSMEAGPMIRKDEIK
GTPWIAAYENNNVDIGLACGLPGRAQIGKGMWAAPDNMAEMVAKKIAHPLSGANTAWVPS
PTAATLHALHYHRVDVAMRQAELRKRPRAKLTDILTIPLAKTNWAPDDIKQEIENNCQGI
LGYVVRWVDQGIGCSKVPDVHDVALMEDRATLRISSQHIANWLRHDIVTKEQVLAALKTM
AVVVDRQNAGDPLYGPMAPNFDGPAFKAALDLIFKGREEPNGYTEGLLASWRREAKAMQA
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcgcagatcggaccgataagcgtcgacacggctttgcgggatttcgtcgag
accgacgtgctgccggggacaggcgtcaaggcggaccagttctggaccggccttgccggg
ctgatcgaggatttcgctccgcgcatccgggcgcaattgcgcttccgcgacgagcttcaa
tccaagatcgacgcctatcacaaaatctacgccgcaagatctttcgacatggccggctat
gaggcgttcctgcgcgagatcggctacattgtccccgagccgccggattttgccatccgc
accgaaaatacgcgcgaggtcgcgcgcgtctcgggtcctcagcttgtcgttcccgcctcg
aatgcgcgctttgttctcaacgcggccaacgcccgctggggcagcctgttcgacgcgctc
tacggctccgacgtcataccggaaacgccaggcgccgaacgcggcaagggctacaacaag
gcgcgcggcgcgcgcgtcattgaatatgcgcgcaacctgctcgacgagctggtcccgctg
tccaagggcagccacaaggacgtcatcagctacaaggtcgccaacggcgaactcgtcgcc
gaactcgacaatgggcttgagacgcggctgaagcatcctggccgtttcgccggctggcgg
aggactggccccggctcctttgtcgtgctgctgcgccagcacggcctgcacatcgaactc
gacattgatcccgtcagccttgtcggctcggaaagcaaatccggcctcgccgacgtcatt
ctcgaagcggcgctcagcgccatcgtcgaccttgaggacagcgtcgccgcggtcgacgcg
caggacaaggtcgacgtctatcgcaactggctcggcctgatgaagggcgaactgtcggcg
acgctcgagaagaagggcctgttgatcgaacggcggctcaatcccgaccgcgtctatacc
gatcgcgacggcgcccccatggccctgcacggacgcagcctgcttctcgtgcgtaatgtc
ggtcatcatgtgcgcaccgacgccgtgctcgatgcggacggtcatgaggttcccgagacc
atcgtcgacgccgccgtcaccgcgctgatcggcatgcatgacgtcaagggcgcgggtccg
atccacaacagccgcagcggctcgatctacatcgtcaaacccaagatgcacgggccggat
gaagtggctctcgccaatgatctgttcggccgggtcgaggatatgctgggcctcgatcgc
ttcacgctcaaaatgggcatcatggatgaggagcggcgcaccacggtcaatctgaaggcc
tgcatttttgccgccgccgaccgagtgttcttcatcaataccggcttcctcgatcgcacc
ggcgacgagatccacacctcgatggaggcgggtccgatgatccgcaaggatgagatcaag
gggacgccctggatcgcggcctatgaaaacaacaatgtggatatcgggctcgcctgcgga
ttgccgggccgagcgcagatcggcaagggcatgtgggctgcgcccgacaacatggccgaa
atggtcgccaagaaaatcgcccatccgctgtcgggcgccaacaccgcctgggtgccttcg
ccgaccgcggcgacgctgcatgcgctgcattaccatcgcgtcgacgtcgccatgcgtcag
gccgagctgcgcaagcgcccgcgcgccaagctcaccgatattctgacgatcccgctggcc
aagaccaattgggcgccggacgacatcaagcaggagatcgaaaacaactgccagggcatt
ttgggctatgtcgtgcgctgggtcgatcagggcatcggctgctccaaggtgccggacgtc
catgacgtcgccctgatggaggatcgcgcgacgctgcggatctcgagccagcacatcgcc
aactggctgcgccatgacatcgtgacgaaagagcaggtgctggccgcgttgaaaaccatg
gccgtcgtcgtcgaccggcagaatgcgggcgatccgctgtatgggccgatggcgccgaat
ttcgacgggccggcgtttaaggcggcgctcgatctcatcttcaagggccgcgaggagccg
aacggctacacggaagggttgctcgcctcctggcggcgcgaagcgaaagctatgcaggcg
tcctga

DBGET integrated database retrieval system