KEGG   Methylocella silvestris: Msil_1325Help
Entry
Msil_1325         CDS       T00802                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
msl  Methylocella silvestris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:msl01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:msl00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:msl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1423900..1426065)
Genome map
AA seq 721 aa AA seqDB search
MAYAQIGPISVDTALRDFVETDVLPGTGVKADQFWTGLAGLIEDFAPRIRAQLRFRDELQ
SKIDAYHKIYAARSFDMAGYEAFLREIGYIVPEPPDFAIRTENTREVARVSGPQLVVPAS
NARFVLNAANARWGSLFDALYGSDVIPETPGAERGKGYNKARGARVIEYARNLLDELVPL
SKGSHKDVISYKVANGELVAELDNGLETRLKHPGRFAGWRRTGPGSFVVLLRQHGLHIEL
DIDPVSLVGSESKSGLADVILEAALSAIVDLEDSVAAVDAQDKVDVYRNWLGLMKGELSA
TLEKKGLLIERRLNPDRVYTDRDGAPMALHGRSLLLVRNVGHHVRTDAVLDADGHEVPET
IVDAAVTALIGMHDVKGAGPIHNSRSGSIYIVKPKMHGPDEVALANDLFGRVEDMLGLDR
FTLKMGIMDEERRTTVNLKACIFAAADRVFFINTGFLDRTGDEIHTSMEAGPMIRKDEIK
GTPWIAAYENNNVDIGLACGLPGRAQIGKGMWAAPDNMAEMVAKKIAHPLSGANTAWVPS
PTAATLHALHYHRVDVAMRQAELRKRPRAKLTDILTIPLAKTNWAPDDIKQEIENNCQGI
LGYVVRWVDQGIGCSKVPDVHDVALMEDRATLRISSQHIANWLRHDIVTKEQVLAALKTM
AVVVDRQNAGDPLYGPMAPNFDGPAFKAALDLIFKGREEPNGYTEGLLASWRREAKAMQA
S
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcgcagatcggaccgataagcgtcgacacggctttgcgggatttcgtcgag
accgacgtgctgccggggacaggcgtcaaggcggaccagttctggaccggccttgccggg
ctgatcgaggatttcgctccgcgcatccgggcgcaattgcgcttccgcgacgagcttcaa
tccaagatcgacgcctatcacaaaatctacgccgcaagatctttcgacatggccggctat
gaggcgttcctgcgcgagatcggctacattgtccccgagccgccggattttgccatccgc
accgaaaatacgcgcgaggtcgcgcgcgtctcgggtcctcagcttgtcgttcccgcctcg
aatgcgcgctttgttctcaacgcggccaacgcccgctggggcagcctgttcgacgcgctc
tacggctccgacgtcataccggaaacgccaggcgccgaacgcggcaagggctacaacaag
gcgcgcggcgcgcgcgtcattgaatatgcgcgcaacctgctcgacgagctggtcccgctg
tccaagggcagccacaaggacgtcatcagctacaaggtcgccaacggcgaactcgtcgcc
gaactcgacaatgggcttgagacgcggctgaagcatcctggccgtttcgccggctggcgg
aggactggccccggctcctttgtcgtgctgctgcgccagcacggcctgcacatcgaactc
gacattgatcccgtcagccttgtcggctcggaaagcaaatccggcctcgccgacgtcatt
ctcgaagcggcgctcagcgccatcgtcgaccttgaggacagcgtcgccgcggtcgacgcg
caggacaaggtcgacgtctatcgcaactggctcggcctgatgaagggcgaactgtcggcg
acgctcgagaagaagggcctgttgatcgaacggcggctcaatcccgaccgcgtctatacc
gatcgcgacggcgcccccatggccctgcacggacgcagcctgcttctcgtgcgtaatgtc
ggtcatcatgtgcgcaccgacgccgtgctcgatgcggacggtcatgaggttcccgagacc
atcgtcgacgccgccgtcaccgcgctgatcggcatgcatgacgtcaagggcgcgggtccg
atccacaacagccgcagcggctcgatctacatcgtcaaacccaagatgcacgggccggat
gaagtggctctcgccaatgatctgttcggccgggtcgaggatatgctgggcctcgatcgc
ttcacgctcaaaatgggcatcatggatgaggagcggcgcaccacggtcaatctgaaggcc
tgcatttttgccgccgccgaccgagtgttcttcatcaataccggcttcctcgatcgcacc
ggcgacgagatccacacctcgatggaggcgggtccgatgatccgcaaggatgagatcaag
gggacgccctggatcgcggcctatgaaaacaacaatgtggatatcgggctcgcctgcgga
ttgccgggccgagcgcagatcggcaagggcatgtgggctgcgcccgacaacatggccgaa
atggtcgccaagaaaatcgcccatccgctgtcgggcgccaacaccgcctgggtgccttcg
ccgaccgcggcgacgctgcatgcgctgcattaccatcgcgtcgacgtcgccatgcgtcag
gccgagctgcgcaagcgcccgcgcgccaagctcaccgatattctgacgatcccgctggcc
aagaccaattgggcgccggacgacatcaagcaggagatcgaaaacaactgccagggcatt
ttgggctatgtcgtgcgctgggtcgatcagggcatcggctgctccaaggtgccggacgtc
catgacgtcgccctgatggaggatcgcgcgacgctgcggatctcgagccagcacatcgcc
aactggctgcgccatgacatcgtgacgaaagagcaggtgctggccgcgttgaaaaccatg
gccgtcgtcgtcgaccggcagaatgcgggcgatccgctgtatgggccgatggcgccgaat
ttcgacgggccggcgtttaaggcggcgctcgatctcatcttcaagggccgcgaggagccg
aacggctacacggaagggttgctcgcctcctggcggcgcgaagcgaaagctatgcaggcg
tcctga

DBGET integrated database retrieval system