KEGG   Methylocella silvestris: Msil_1402Help
Entry
Msil_1402         CDS       T00802                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msl  Methylocella silvestris
Pathway
msl00260  Glycine, serine and threonine metabolism
msl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msl01100  Metabolic pathways
msl01110  Biosynthesis of secondary metabolites
msl01130  Biosynthesis of antibiotics
msl01230  Biosynthesis of amino acids
Module
msl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msil_1402
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msil_1402
Enzymes [BR:msl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msil_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF561
Motif
Other DBs
NCBI-ProteinID: ACK50367
JGI: Msil1402
UniProt: B8ESN2
Position
1514419..1515267
Genome map
AA seq 282 aa AA seqDB search
MHNFSSTRIDRRFKDLAVEGRAALVAFVMAGDPDLATSLDILKALPKAGADVIEVGMPFT
DPMADGPAIQAAGLRALAAGATLAKTLKLVADFRGEDQTTPIVLMGYYNPIYVYGVDAFL
EAAKESGVDGLIVVDLPPEEDSELCLPALAAGLNFIRLATPTTDDARLPAVLANTSGFVY
YVSITGTTGAATPNFSATASAVARIKRHTGLPVAVGFGVKTAADAAAIAAHADGVVVGSA
IVDALRGSLDAEGRATPGTVPAVAKLVEDLAGGVRTAARAPA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatttttcttcaacgcgtatcgaccgccgcttcaaagacctcgctgtcgagggc
cgcgcggcgctcgtcgccttcgtcatggcgggcgatcccgatctggcgacgagcctcgat
atcctgaaggcgctgcccaaagccggcgccgatgtgatcgaggtcggaatgcccttcacc
gacccaatggccgacgggccggcgatccaggccgccggcctccgcgctcttgcggcgggc
gccactctggcaaaaaccctaaagctcgtcgccgacttccgcggcgaggatcaaacgacg
ccgatcgtgctgatgggctattacaatccaatctacgtctatggcgtcgacgcctttctc
gaggccgcgaaagagtcgggcgtcgacgggctgatcgtggtcgatcttccgccggaagaa
gattccgagctttgcctgccggcgctggccgcggggctcaatttcatccgtctcgcgacg
ccgacgaccgacgacgcccgcctcccggccgtgctcgcgaacacctccggctttgtctat
tatgtctcgatcaccggcacgaccggcgcagcgacgccgaatttttcggcgacggcgagc
gccgtcgcgcggatcaagcgccataccggactgcccgtcgcggtcggattcggcgtcaag
accgccgccgacgccgcggcgatcgcagcccatgccgacggggtcgtggtcggatcggcg
atcgtcgacgcgctgcgcggctcgctcgacgccgagggccgcgcgacccccggcacggtc
ccggcagtggcgaagctcgtcgaagatcttgccggcggcgtccgaaccgctgcgcgggcg
ccggcttga

DBGET integrated database retrieval system