KEGG   Methylocella silvestris: Msil_1402Help
Entry
Msil_1402         CDS       T00802                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msl  Methylocella silvestris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msil_1402
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msil_1402
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msil_1402
Enzymes [BR:msl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msil_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1514419..1515267
Genome map
AA seq 282 aa AA seqDB search
MHNFSSTRIDRRFKDLAVEGRAALVAFVMAGDPDLATSLDILKALPKAGADVIEVGMPFT
DPMADGPAIQAAGLRALAAGATLAKTLKLVADFRGEDQTTPIVLMGYYNPIYVYGVDAFL
EAAKESGVDGLIVVDLPPEEDSELCLPALAAGLNFIRLATPTTDDARLPAVLANTSGFVY
YVSITGTTGAATPNFSATASAVARIKRHTGLPVAVGFGVKTAADAAAIAAHADGVVVGSA
IVDALRGSLDAEGRATPGTVPAVAKLVEDLAGGVRTAARAPA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatttttcttcaacgcgtatcgaccgccgcttcaaagacctcgctgtcgagggc
cgcgcggcgctcgtcgccttcgtcatggcgggcgatcccgatctggcgacgagcctcgat
atcctgaaggcgctgcccaaagccggcgccgatgtgatcgaggtcggaatgcccttcacc
gacccaatggccgacgggccggcgatccaggccgccggcctccgcgctcttgcggcgggc
gccactctggcaaaaaccctaaagctcgtcgccgacttccgcggcgaggatcaaacgacg
ccgatcgtgctgatgggctattacaatccaatctacgtctatggcgtcgacgcctttctc
gaggccgcgaaagagtcgggcgtcgacgggctgatcgtggtcgatcttccgccggaagaa
gattccgagctttgcctgccggcgctggccgcggggctcaatttcatccgtctcgcgacg
ccgacgaccgacgacgcccgcctcccggccgtgctcgcgaacacctccggctttgtctat
tatgtctcgatcaccggcacgaccggcgcagcgacgccgaatttttcggcgacggcgagc
gccgtcgcgcggatcaagcgccataccggactgcccgtcgcggtcggattcggcgtcaag
accgccgccgacgccgcggcgatcgcagcccatgccgacggggtcgtggtcggatcggcg
atcgtcgacgcgctgcgcggctcgctcgacgccgagggccgcgcgacccccggcacggtc
ccggcagtggcgaagctcgtcgaagatcttgccggcggcgtccgaaccgctgcgcgggcg
ccggcttga

DBGET integrated database retrieval system