KEGG   Methylocella silvestris: Msil_1443Help
Entry
Msil_1443         CDS       T00802                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
msl  Methylocella silvestris
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Msil_1443
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Msil_1443
Enzymes [BR:msl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Msil_1443
Two-component system [BR:msl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Msil_1443
Bacterial motility proteins [BR:msl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Msil_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1559390..1560415)
Genome map
AA seq 341 aa AA seqDB search
MTPTRVLIVDDSATVRGLIRILLTRDPAIEIVGEAADPLEARAAIKATDPDVITLDVEMP
KMNGLDFLDRLMRLRPTPVIMVSSLTAAGAETAIAALEMGAFDCVGKPGSGEQEQFGDVL
LAKVKAAAGLRGRPRRESARQPAAERQPYRSDGRIVAIGASTGGVEALIAVLSQFPANGP
PTVITQHMPATFTKSFAGRLDRLCRPAVCEAYDGAPLTPGAVYLAPGGAAHLRVEAGAPP
RCRLVKSAPVNGHRPSVDVLFTSVTDAVGARAVGAILTGMGRDGAEGLLAMRSAGCQTFG
QSESSCLIYGMPKIAFELGATQKQVSLATMASEILRATCAA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactcccactcgcgtcctcatcgtcgatgattcggcgaccgtcagaggcctgatccga
attctgctcacgcgcgatccggcgatcgagatcgtcggcgaggccgccgacccgctcgag
gcccgcgccgccatcaaggcgaccgatcccgacgtcatcacgctcgacgtcgaaatgccg
aagatgaacgggctcgactttctcgaccggctgatgcggctgcggccgaccccggtgatc
atggtttcgagcctcaccgccgcgggcgccgagacggcgatcgccgcgctcgaaatgggc
gccttcgattgtgttggcaagccgggcagcggcgagcaggagcaattcggggatgtgctg
ctcgccaaggtcaaagccgcggcggggcttcgcggacggccgcgccgcgaatcggcgcgg
cagccggcggccgaacgccaaccctatcgcagcgacggtcgcatcgtcgccatcggcgcc
tcgaccggcggcgtcgaggccctgatcgcggtgctgtcgcaatttcctgcaaacgggccg
ccgaccgtcatcacgcaacacatgccggcgaccttcacgaaaagctttgccggccgtctc
gaccggctgtgccggcccgccgtctgcgaggcttatgacggcgcgccgctgactccgggc
gcggtctatctcgcacccggcggcgcggcgcatctgcgcgtcgaggcgggcgctccgccg
cgctgccgcctcgtcaaaagcgcgcccgtcaatggacatcgaccttcggtcgacgtgttg
ttcacttccgtcactgatgcggtcggcgcgcgcgcggtgggcgcgatactcacgggcatg
ggccgcgacggcgccgagggactgctcgccatgcggagcgctggctgccagaccttcggc
cagagcgaatcctcatgcctcatctatggaatgccgaaaatcgcctttgagttgggcgca
acccagaagcaggtttcgctcgctacgatggcgtcggaaatcctgcgcgccacttgcgct
gcataa

DBGET integrated database retrieval system