KEGG   Methylocella silvestris: Msil_1581Help
Entry
Msil_1581         CDS       T00802                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
msl  Methylocella silvestris
Pathway
msl00790  Folate biosynthesis
msl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Msil_1581
Enzymes [BR:msl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Msil_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF2188
Motif
Other DBs
NCBI-ProteinID: ACK50530
JGI: Msil1581
UniProt: B8EI48
Position
complement(1710116..1710988)
Genome map
AA seq 290 aa AA seqDB search
MSETGAIAVDPDSMAHKRDAFLARIGLGALIMGIVNVTPDSFSDGGKFETAAAAVAQARR
LAQEGAAIIDVGAESTRPGHEPVPAEVERARLEPLLGAIVASVAEPVSIDTSKASVARFA
TGQGVAFINDVWGLQRDPAMADVVAESGAGVVIMHNRGELDPECDIVDDMRRFFDKSLML
AEKAGVPRQRIILDPGVGFGKTRQQNLQAIHGMRALLTYELPILLGVSRKSLLRSLVPDA
PVSAAQVEPRLVATIAANLAGAAAGAAIFRVHDVADHVAAFKVFDAIERA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgaaaccggcgcgatcgccgtcgacccggattcgatggcgcataaacgggacgca
ttcctcgcccgcatcggccttggcgcgctaatcatgggcatcgtcaatgtgacgccggat
tccttttccgacggcggcaaattcgaaacagccgctgcggcggtggcgcaggcgcgcagg
ctcgcgcaggagggcgcggcgatcatcgacgtcggagcggaatcgacgcggcccggacac
gagcccgtgcccgccgaggtggaacgcgcacggctcgagccgctgctaggcgcgatcgtc
gcgagcgtcgcggagcctgtctcgatcgacacctccaaggcctcggtcgcccgcttcgcc
accgggcagggcgtcgccttcatcaatgatgtctggggtctgcaacgcgatccggccatg
gccgacgtcgtcgccgagagcggggcgggcgtcgtcatcatgcataatcgcggcgagctc
gaccccgaatgcgacattgtcgacgacatgcggcgcttcttcgacaaatccctgatgctt
gctgaaaaagcgggcgtgccgcgccagcgcatcatcctcgatccgggcgtcggcttcggc
aagacgcggcagcaaaaccttcaggccattcatggcatgcgcgcgcttttgacgtatgag
ctgccgatcctgctcggcgtctcgcgcaaatccttgctccggtcgctggtgccggacgcg
cccgtgtccgcagcgcaggtcgagccgcggcttgtcgccacgatcgccgctaatctcgcc
ggggcggcggcgggcgccgccatttttcgcgtgcatgacgtcgccgatcatgtcgccgcc
ttcaaggttttcgatgctatcgaacgggcctga

DBGET integrated database retrieval system