KEGG   Methylocella silvestris: Msil_1644Help
Entry
Msil_1644         CDS       T00802                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
msl  Methylocella silvestris
Pathway
msl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Msil_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 OmdA
Motif
Other DBs
NCBI-ProteinID: ACK50592
JGI: Msil1644
UniProt: B8EK52
Position
complement(1777384..1777785)
Genome map
AA seq 133 aa AA seqDB search
MKRRRIAVCGAPLVLAAFGLLYGVASVRAEDADPGKQQFNTSCGVCHSVDPNAAVRQGPN
LFSVYGRKVASVPGFSYSNVLKSGDWIWDESTLDPWIANAQEAHPGAFMAYRQADPQKRR
LVINYLKSLSTSK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggcggcgcatcgccgtctgcggcgcgccgcttgtgttggcggcgttcggtttg
ctctatggcgtcgcgagcgtgcgcgccgaggacgccgacccgggcaagcagcagttcaat
acgagctgcggcgtatgccattcggttgatccaaacgccgccgtgcggcagggtccaaat
ctcttttcagtatatggacgaaaggtcgcgagcgttccgggcttttcctactccaatgta
ttgaaatcgggcgactggatctgggacgaatccacgctcgatccatggatcgccaatgcg
caggaggcccatcccggggccttcatggcctatcgccaggcggatccacagaagcgaagg
ctcgtgatcaactatctaaaatcgctgtcgacgtcgaaatga

DBGET integrated database retrieval system