KEGG   Methylocella silvestris: Msil_1644Help
Entry
Msil_1644         CDS       T00802                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
msl  Methylocella silvestris
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Msil_1644
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Msil_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1777384..1777785)
Genome map
AA seq 133 aa AA seqDB search
MKRRRIAVCGAPLVLAAFGLLYGVASVRAEDADPGKQQFNTSCGVCHSVDPNAAVRQGPN
LFSVYGRKVASVPGFSYSNVLKSGDWIWDESTLDPWIANAQEAHPGAFMAYRQADPQKRR
LVINYLKSLSTSK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaggcggcgcatcgccgtctgcggcgcgccgcttgtgttggcggcgttcggtttg
ctctatggcgtcgcgagcgtgcgcgccgaggacgccgacccgggcaagcagcagttcaat
acgagctgcggcgtatgccattcggttgatccaaacgccgccgtgcggcagggtccaaat
ctcttttcagtatatggacgaaaggtcgcgagcgttccgggcttttcctactccaatgta
ttgaaatcgggcgactggatctgggacgaatccacgctcgatccatggatcgccaatgcg
caggaggcccatcccggggccttcatggcctatcgccaggcggatccacagaagcgaagg
ctcgtgatcaactatctaaaatcgctgtcgacgtcgaaatga

DBGET integrated database retrieval system