KEGG   Methylocella silvestris: Msil_1691Help
Entry
Msil_1691         CDS       T00802                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
msl  Methylocella silvestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1834338..1835030)
Genome map
AA seq 230 aa AA seqDB search
MQDAGNSDPWESSRRTMVDRQIRTFDVTDSAVIDRMLAVPREKFLPASLEPLAYSDSALL
LPGAAGERPRSLLPPLVLARLLQGARLLPTDKALVVSAGSGYSTALVAGLAADVVAVESD
PSLYGALRGSLDAFGLTQVRTLQTPLVVGAPNDAPFDVILIDGGVAGRLDPLLEQLKDGG
RLVTVQQMADGACKAVRYDKADGATGYRILFDASAPVLDAFRPVEEFTFS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcgggcaattccgatccttgggagtcgtccaggcgcacaatggtcgatcgc
caaatccggacgtttgacgtcacggattcggctgtaatcgatcgaatgctggcggttccg
cgcgagaaatttctccccgcgagccttgagccattggcctattcggactcggcgctgctc
cttcccggagctgccggcgagcggccgcgcagccttctgccgccgctggtgctggcccgt
cttttacagggcgcgcgccttctgcccaccgacaaggctttggtcgtctcggcggggagc
ggctattcgacggctcttgtcgctggacttgcggccgacgtggtcgccgtcgagtccgat
ccgtcgctctatggcgcactgcgcggcagccttgacgctttcggcctcacccaagtccgt
acgctgcagacgccgctggtcgtcggcgcgcccaacgatgcgcccttcgacgttattctc
attgacggcggggttgctggccggctcgatcctttgctggagcaactgaaagacggcggg
cgcctcgtaaccgtgcagcaaatggcggatggggcgtgcaaggccgtgcgctatgacaaa
gcggatggcgcgaccggttaccgcatcctgttcgacgcctccgcgcctgtgctcgacgcg
ttcaggccggtcgaagaattcacgtttagttga

DBGET integrated database retrieval system