KEGG   Methylocella silvestris: Msil_1696Help
Entry
Msil_1696         CDS       T00802                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
msl  Methylocella silvestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1839961..1841262)
Genome map
AA seq 433 aa AA seqDB search
MIFLFFGRAARSTIAAAALAASCAFFASPSSALDKTDAQPGDAAPGQSRAAVFQRVKKLA
DVGQRLFADPGLSASGSMSCATCHDAAKGFAPANALAVQLGGKNLDQAGLRAAPGLTYLQ
TTPRFTEHYHESDDDGDESVDAGPTGGLMWDGRINQVAAQALFPLFSPYEMANEDHAALA
RVIDAKYGAELRAIMEGTMPEGEDFALRAAAKALQAYQETPAAFFPYNSKYDFFLKGQVA
LTDQEKHGLDLFNDEKKGNCASCHFSAQPKPGVMPQFSDAGFIALGLPRNKDIPRNADPA
FFDLGLCGPERTDFKDQTDYCGTFKAPTLRNVALRQSFFHNGVFHDLREAVAFYVERDVK
PEKYYPRRIDGTVDKFNDLPVQYRANINNDPPFGGKPGDAPAMTDAEIDDVVAFLKTLTD
GYAPPSPETHADR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgatttttttatttttcgggcgcgcagcccgctcgacgattgccgcggcggcgcttgcg
gcgagttgcgctttctttgcgtcgccttccagcgctctcgataagactgacgcgcagccc
ggcgacgccgcgccgggacaatcgcgcgccgccgtctttcagcgcgtcaagaagcttgcg
gatgtcggccagcggctgttcgccgatcctggcctctcggcgtcaggttcgatgtcctgc
gcgacttgccatgacgccgccaagggatttgcgccggccaatgcgctggccgtgcaactc
ggcggcaaaaatctcgatcaggctgggctacgcgccgcgccaggcctgacctatctgcag
acgacgccgcgcttcaccgagcattatcatgagtcggacgatgacggcgatgagagcgtc
gacgccggtccgaccggcggattgatgtgggacggccgcatcaatcaggtggccgctcag
gccttgtttccattgttctcgccctatgagatggcgaatgaggatcacgccgcgctggcg
cgcgtcatcgacgcgaaatatggcgccgaactgcgcgcgatcatggaagggacaatgccg
gagggcgaagacttcgcgttgcgcgcggccgccaaggcgctgcaggcctatcaggaaacg
cccgccgcattctttccctacaacagcaaatatgattttttcctcaaaggccaggtcgcc
ttgacggaccaggaaaaacacggtctcgacctcttcaacgacgagaaaaagggcaattgc
gcgagctgccatttttcggcgcagccaaagcccggcgttatgccgcagttcagcgacgcc
ggcttcatcgccctcggcctgccgcgcaacaaggatattccgcgcaacgccgacccggcc
ttcttcgatctcggcctctgcgggccggagcgcacggatttcaaggatcagaccgactat
tgcgggacgtttaaggcgccgaccctgcgcaacgtcgctctgcgtcagagctttttccac
aatggcgtctttcacgatctgcgtgaggctgtggctttctatgtcgagcgtgatgtgaag
ccggaaaagtattatccgcgccgcattgacggaaccgtcgacaaattcaacgatctgccg
gtgcaatatcgggccaacatcaacaatgatccgccgttcggcggcaagccgggcgatgcg
ccggcgatgaccgacgccgagatcgacgatgtggtggcgtttctcaagacgctgaccgac
ggctatgcgccgccctcgccggagacgcacgccgatcgctaa

DBGET integrated database retrieval system