KEGG   Methylocella silvestris: Msil_1948Help
Entry
Msil_1948         CDS       T00802                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
msl  Methylocella silvestris
Brite
Enzymes [BR:msl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Msil_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2122339..2125287
Genome map
AA seq 982 aa AA seqDB search
MKLKFDPSLQYQQDAVSAVVGAFEGQPFVQTGAMAFQSLQIGGLFQTELGLGNLLNIGDE
QILANVRAVQEANEIEKVIALNGREFSVEMETGTGKTYVYLRTIFELNKTYGFKKFIIVV
PSVAIREGVLKSIEVTKEHFHTLYDNAPFDHFVYDSKRLGKVRQFATSNQIQIMVINIQS
FQKDVADKDLSEMTEDELKKLNVINRENDRMSGRRPIEFIQAASPVVIIDEPQSVDTTEK
SRRAIGNLNPMATLRYSATHRNPYNLLYKLDPIKAYDLRLVKRIEVASVRSDDNFNDAYV
KLLKTDNKTGIKAQIEIHREGATGPKAAKLWVKQGDDLYVKSDERDAYRDGYIVQNIDCT
PGSEYIEFNQGRFLELGQEVGGLGEDIMKAQVYETVEQHLKKERALKGKGIKVLSLFFID
RVANYRIYNEDGTTSLGKIGQWFEEAYQQLTAKPIYKGLIPFSVADVHNGYFSQDKQGHA
KDTRGNTADDDDTYSLIMRDKERLLDPNVALRFIFSHSALREGWDNPNVFQICTLNETQS
AERKRQEIGRGLRLPVNETGERVHDETINRLTVIANESYEDFARTLQTEFEEDFGIKFGR
IEKIAFAKLVRRAADGTDVELGQDESVKIWHELVAKGYLNGAGDILEKFDPKNPHFKLEI
SDAFADLRAEIIDEVNRKLFKNRIVNVRDERTLKFRKEVHLSADFQALWDKIKHRTRYRV
TFETAALIDRALSRIKQIEPIKAARIETTVVEVDITDAGVSADRQISSRVRDVQQVKVLP
DILAFLQKETELTRHTLAEILKRSGRLGEFKINPQAFMAAAAKEISRALHDLMLEGIKYE
KVAGQHWEMSRIEQDAEDGIVRYLGNLYEVQNREKSLFDAIVYESEVEKQFARDLDSNEN
VKLFVKLPSWFKIDTPIGTYNPDWAFVTEREEKLYFVRETKSTLDSEERRTKENQKIACG
RKHFDSLGVDYAVVTSLADVAM
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaattcgatccctcacttcagtaccagcaggatgccgtcagcgccgtcgtt
ggggcgttcgaggggcagcccttcgtgcagaccggggcaatggcgtttcagtcgcttcag
atcggcggtctgtttcagacggagctggggctgggcaatctcctcaacattggcgatgag
caaattctcgcaaacgtccgggccgttcaggaagctaatgagatcgagaaggtaattgcc
ctcaacgggcgtgagttctcagtcgagatggagaccggcaccggcaagacctacgtctat
cttcggacgatttttgagctgaacaagacctacggcttcaagaagtttatcatcgtggtt
ccgagtgtcgccattcgtgagggcgtgcttaagagcatcgaggtaacgaaggagcacttc
cacacgctctacgacaacgcgcccttcgatcactttgtctatgactcaaagcgtctaggc
aaagtgcgccagttcgcgaccagcaatcagattcagatcatggtcatcaacatccagtcc
ttccagaaggatgttgccgacaaggacctctcggagatgaccgaggatgagctgaagaag
ctcaatgtcatcaaccgtgagaatgatcgcatgtcgggccgcaggcctatcgagttcatt
caggcggccagccccgttgtcatcatcgacgaaccccagagcgtcgatacgaccgagaaa
tcacggcgggcgattggcaacctcaatccaatggcgacgctgcgttacagcgcgacgcat
cgcaatccctataacctcctctacaagctcgacccgatcaaggcttacgacctacggctc
gtgaagaggatcgaagtcgcatccgtccggtcggatgacaatttcaatgatgcatacgtg
aagctgctcaagacagacaacaagaccggcatcaaagcgcaaatcgagattcacagggaa
ggtgccactggccccaaagcggcgaagctttgggtcaagcagggcgatgacttgtacgtg
aagtcggacgagcgcgacgcttatcgcgacggctacatcgtgcagaacatcgattgcact
ccgggctccgaatatatcgagttcaatcaaggccgcttccttgagctgggtcaggaagtc
ggcgggcttggcgaagacattatgaaggctcaggtctatgagaccgtcgagcagcatcta
aagaaggagcgcgccctgaagggcaagggcatcaaggtgctctcgctgttcttcatcgac
cgcgtcgccaactaccgcatctacaatgaggacgggacgaccagccttggcaagatcggt
cagtggtttgaggaggcctatcagcagctcacggccaagcccatctacaagggccttatc
ccattcagcgttgccgatgttcacaacggctacttctcgcaggacaagcagggccacgcc
aaggacacacgcgggaacaccgccgacgatgatgacacttacagcctcatcatgcgcgac
aaggagcggcttctcgatcctaacgttgcactgcgcttcatcttctcccactccgccctg
cgcgagggctgggacaatccaaatgtgttccagatttgcaccctgaacgagacgcaatca
gccgagcgcaagcggcaggaaatcgggcgcgggttgcgtctgcctgtcaatgagaccggc
gagcgcgttcatgacgaaacgatcaatcgtctgaccgtcatcgccaacgagtcatatgag
gattttgcgcgcacgcttcagaccgagtttgaagaggattttggcatcaagttcggaagg
atcgagaagatcgctttcgcaaagctcgtgcgacgggctgcggatggaaccgatgtcgaa
ctcgggcaggacgagtccgtgaagatttggcacgagctcgttgcgaagggctacctaaat
ggcgcgggcgatattctggagaagtttgacccgaagaacccccatttcaaactggaaatt
tcagacgcgttcgctgatctccgggcggaaatcatcgacgaggtgaaccgcaagctcttc
aagaaccgtatcgtcaatgtccgcgatgagcgcaccctgaaattccggaaagaggtgcat
ctcagcgccgacttccaggctctctgggataagatcaaacatcgcacgcgttaccgcgtg
acttttgaaaccgctgcactgatcgaccgggcgctctcgcgcatcaagcagatcgaaccg
atcaaggcagcgcgcatcgagaccaccgtcgttgaggtggatattaccgatgccggtgtc
tccgccgaccgacagatttcgtcgcgagtgagggacgtgcagcaggtaaaggtcttgccg
gacattctcgccttcctgcagaaggagactgagctgacccgccacacgcttgccgaaatc
ctcaagcgctcggggcggctcggcgagttcaagattaatccgcaggctttcatggcagcc
gctgcgaaggaaatatcgcgcgcgctgcatgacctgatgctcgaaggcatcaaatacgag
aaggtcgcaggccagcattgggaaatgagccggatcgagcaggatgccgaagacggcatc
gtccggtatctcggcaatctctatgaggttcaaaaccgcgagaagtcgctcttcgatgca
attgtttatgaatccgaggttgagaagcaattcgcacgcgacctcgacagcaatgagaac
gtgaagctattcgtcaagctgccgtcgtggttcaagatcgacacgcccatcggcacctat
aatcccgactgggcctttgtgaccgagcgcgaggagaagctttatttcgttcgtgagacg
aagagcacgctcgacagcgaggagcggcgcactaaggaaaaccaaaagatcgcctgtggt
cgcaagcatttcgattcgcttggggtagactatgccgtggtcacttcgcttgcagacgtg
gcgatgtga

DBGET integrated database retrieval system