KEGG   Methylocella silvestris: Msil_2067Help
Entry
Msil_2067         CDS       T00802                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
msl  Methylocella silvestris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msil_2067 (bchD)
Enzymes [BR:msl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Msil_2067 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2241053..2242816)
Genome map
AA seq 587 aa AA seqDB search
MSETGACGGGDTWRDPLLAAALFAIDPAGLRGIVLRARSGPAREAFLSWLTRLLPEATPL
RRVPIGVPDSRLLGGLDLTETLRLGRPVAERGLLAESDGGIILLAMAERLEPVAAARIAA
TLDTAEVSIERDGLALKAPARFGVVALDEGASHDERAPAALTDRLGFLVDLSEHALRDFI
EPPWTAADIAAARARLGAVDIDAATIAHLNAAAMALGVESLRALLLAAQSARAAAALAGR
TQVSTADAACAAALVLAPRAQTSPSSDDPPQAPEQDDGDSDAPPDSDGETVDPSAEELVV
EAARAAVPPGMMERLQRASSGPRGSGGKSGGVKRSGLRGRPAGAVEGAPKDGQRLNVIET
LRAAAPWRKLRGGARAGGEGRLPIERQDFRVTRVKQRSQTVTIFVVDASGSSALNRLAEA
KGAVELLLAECYVRRDEVALLAFRGDRVELLLAPTRSLLRAKRSLSDMPGGGATPLADGI
TAAVRLAEDEKRKGRSPFIVLMTDGAANISAGGMAAGRKRAKEDALDAARLARAAGLEAA
LIDISPRPQPDAERLAAEMNARYLPLPFADASALAQAARRPPARFTG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagactggcgcctgcggcggcggcgacacatggcgcgaccccttgctggccgcg
gcgctgttcgcaatcgatccggctggactgcgggggatcgtgcttcgcgccaggagcggg
cccgcgcgggaggcgtttttgtcctggctgacccgcctgctcccagaagcaacgccgcta
cgccgcgttccgatcggcgttccggacagccgccttctcggcggccttgatctcaccgaa
actctgcgtctcggccgtcccgtcgccgagcgcggcctgcttgccgaaagcgacggcgga
atcatcctgctcgccatggccgagcgccttgaacccgtcgcggctgcgcgcatcgccgca
acgctcgacacggcggaagtgagcatcgagcgcgacggcctggcgctgaaggcgcccgcg
cggttcggcgtcgtggcgctggatgaaggcgcctcccacgatgagcgcgcgcctgccgcg
ctgaccgaccgcctcggctttctcgtggacctttcggagcatgcgctccgcgacttcatt
gagccgccctggaccgcggcggacatcgcggcggcgcgggcgcgcttgggcgccgtcgat
atcgatgcggcgacgatcgcgcatctcaacgccgcggcgatggccctcggcgttgaatcg
ctgcgcgcgctgctgcttgccgcgcaatcagccagggcggcggcggcgcttgccggccgg
acacaggtttcgaccgcggacgcggcctgtgccgccgccctggtgcttgcgccgcgcgcg
caaacctcgccatcctccgacgatccgccgcaggcgccggaacaggatgacggcgacagc
gatgcgccgcccgatagcgacggtgagactgtcgatccatcggccgaagaactcgtcgtc
gaggcggcccgcgccgccgttccgcccggcatgatggagcgcctgcagcgcgcctccagc
ggaccgcgcggctctggcggcaaatccggcggcgtcaaacggtcaggcctgcgtggccgc
cccgccggcgccgtcgagggcgcgccgaaagacggacagcgactcaacgtcatcgagacg
ctgcgcgccgccgcgccctggcgcaagctccgcggcggcgcgcgcgccggaggcgagggg
cgcctgccgatcgagcgtcaggattttcgcgtcacgcgcgtcaaacagcgctcgcagacc
gtaacaatttttgtggtcgacgcgtcggggtcctcggcgctgaaccggctggcggaagcc
aagggcgccgtcgaactgcttctcgccgaatgttatgtccgccgcgatgaagtggcattg
ctggcgtttcgcggcgaccgcgtggagttgttgctggcgccgacgcgttcgctgcttcgc
gccaaacgaagtctctcggacatgccgggcggcggcgcgactccgcttgctgatggaatt
actgctgcggtgcgccttgcggaggacgaaaagcgcaagggccgctcgcccttcatcgtc
ctgatgacggacggcgccgcaaatatttcagccggcggcatggcggccggacgaaaacgg
gcaaaggaagacgcgctcgacgccgcacggctcgcccgcgcggccggcctcgaggcggcg
ttgatcgatatttcgccgcggccccagcccgacgccgagcggctcgcggcggaaatgaac
gcgcgctatctgccgctaccgttcgccgatgcgtccgcactggcgcaggcggcgcgccgc
ccgccggcgcggttcacgggctga

DBGET integrated database retrieval system