KEGG   Methylocella silvestris: Msil_2248Help
Entry
Msil_2248         CDS       T00802                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msl  Methylocella silvestris
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Msil_2248
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Msil_2248
Enzymes [BR:msl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Msil_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2434180..2435277)
Genome map
AA seq 365 aa AA seqDB search
MGAASIDSVGDHFFIGLRPTPVLDDRDRALLQDLRPAGVVLFKSNFRHDLPYEGWLASHL
RLIEEIRAAAARPNLLISIDHEGGRVCRTPEPMTRYAYAARWAGRAAGVGRAMGRELASL
GVNLNFAPVLDIHTNPANPVIGERAFGSTPDEVIAAALPFMRAMQKQGVLACGKHFPGHG
DTHVDSHLGLPSQPASLDELRQRELRPFAAAIGGGLRMLMSSHISFPLIDPDAPVTLSRR
FLTEILRQELGFKGVVVSDDIGMAAMKGFFEDPAAAAKLIAAGSDMLMVCAAFTRADRAR
DFARAIVTARDEGRLDPVVLARSKARIAALLAKAPLHQVQLLPDSSFATHRAAGALFSAA
TVEVM
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgcatcaatcgattccgtaggcgaccatttcttcatcgggctgcggccgact
ccggtcctcgacgatcgcgaccgcgccctgctgcaagatctgcggcccgccggcgtcgtt
ttgttcaagagcaatttccgccacgatctgccctatgagggatggctcgccagccatctg
aggctgattgaggagattcgcgcggccgcggcgcggccgaacctgctgatctccatcgat
cacgagggcggccgggtgtgccgcacgccggagccgatgacgcgctatgcctatgcggcg
cgctgggcggggcgcgccgccggcgtcggccgggcgatgggacgcgagctcgcaagcctc
ggcgtcaacctcaattttgcgcccgttctcgatatccacaccaatcccgccaatccggtg
attggcgagcgggcgttcggctcaacgcccgacgaagtcattgcagcggcgctccccttc
atgcgcgcgatgcagaagcagggcgtgctcgcctgcggcaagcatttccccggacatggc
gacacgcatgtcgattcgcatctcggcctgccctcgcagccggcaagtctcgacgaattg
cgccaacgcgaattgcggcccttcgcggcggcgatcggcggcggccttcgcatgctgatg
agctcgcacatctcctttccgctcatcgatcccgacgctcccgtcactctgtcgcgccga
tttctgaccgagatcctgcgccaggagcttggcttcaaaggggtcgtcgtatccgacgat
atcggcatggcggcgatgaaggggtttttcgaggatccggccgcggccgccaagctgatc
gccgcggggtccgacatgctgatggtctgcgccgctttcacgcgcgccgaccgcgcccgc
gatttcgcccgcgccatcgtcacggcgcgcgacgaggggcggctcgatccggtcgtgctg
gcgcggtcgaaggcgcgcatcgccgctttgctcgccaaggcgccgctgcatcaggtccag
cttctgcccgattcatccttcgcgacgcatcgcgccgcgggcgccttgttttcggccgcg
actgttgaagtcatgtga

DBGET integrated database retrieval system